Clone BO29161 Report

Search the DGRC for BO29161

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:291
Well:61
Vector:pDNR-Dual
Associated Gene/TranscriptCG6999-RA
Protein status:BO29161.pep: Imported from assembly
Sequenced Size:781

Clone Sequence Records

BO29161.complete Sequence

781 bp assembled on 2011-08-26

GenBank Submission: KX796330

> BO29161.complete
GAAGTTATCAGTCGACATGAAAAAAATAATTAATACATCAAAGCCAAAGC
GCAAGTCCACTTCCATGAAAGTGGAGGAGACTAAGCTAGACGAGGCGCGC
TGGGGTAAGCCGCAGACAAAGGAAGGTGAGTCTGCAAATGGGATAGCAAA
TCCCTCAAATGACGATAAAAAGGAGCTGGCCAATTTCAAAGCCACCTTCA
ATTCCTGGGCCCCCGAGAAGAAACGCGAGAAGATGCACAAGGTAGGCGTC
ATCTTAATATCCAACATACCCAAGGACATGGACGGGGACTGCCTGAAGGA
AATCATGAACTTGCACAGCGTCGTCGGCAGAGTTTACGTGCAGCCGGAAA
CGCTGTCAAGTTTCAAGACAAAGAAGAACATGCGTAAGGGCTGGGTGGAG
TTCATTTCGAAAAGTGGGGCCAAAAAAATCGCTCTAGAGCTGAACAATAA
GCCTATAACCGATGGCAAGTCGTCCCGATTCCGTGGCTTGCTGTGGAAAA
TGAAGTTCCTGCCACGCTTCAAGTGGTACTATCTAACCGATCGCATGGAC
TACGAGCTGGCGGTTTGCAAAGTTCGCGTATGGTCGCAGGCCCGCAAGCG
GGCCACCTTCTGGTACGATCCCGACCAGATGGAGTATTTCAAGAAGCAAG
TGAAGAAGATGAAGAAGATGAAGAAGGTCAAGGAAGCGGAGATGGCTACC
AGGAATGCGGAGATGGCTGCCAAGAAAGCGGAGATGGCTGCCAAGAAATT
GAAGAAGTCTGCCGCAAGCTTTCTAGACCAT

BO29161.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:46:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG6999-RA 702 CG6999-PA 1..699 65..763 3495 100 Plus
CG32706-RA 693 CG32706-PA 1..690 65..763 3220 97.7 Plus
CG32708-RA 720 CG32708-PA 1..363 17..388 515 77.1 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:46:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG6999-RA 875 CG6999-RA 57..803 17..763 3735 100 Plus
CG32706-RA 872 CG32706-RA 68..805 17..763 3460 97.9 Plus
CG32708-RA 855 CG32708-RA 54..416 17..388 515 77.1 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 00:46:43
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 9088839..9089242 360..763 2020 100 Plus
X 23542271 X 9087612..9088006 360..763 1820 97.3 Plus
X 23542271 X 9088423..9088767 17..361 1725 100 Plus
X 23542271 X 9087196..9087540 17..361 1650 98.6 Plus
X 23542271 X 9085985..9086320 17..361 470 77 Plus
X 23542271 X 9086448..9086626 387..565 355 79.9 Plus
X 23542271 X 22143179..22143299 106..223 195 79.3 Plus
X 23542271 X 22147910..22148030 106..223 195 79.3 Plus
X 23542271 X 22152963..22153083 106..223 195 79.3 Plus
X 23542271 X 22158008..22158128 106..223 195 79.3 Plus
X 23542271 X 22167776..22167896 106..223 195 79.3 Plus
X 23542271 X 22187491..22187611 106..223 195 79.3 Plus
X 23542271 X 22192394..22192514 106..223 195 79.3 Plus
X 23542271 X 22197295..22197415 106..223 195 79.3 Plus
X 23542271 X 22202304..22202424 106..223 195 79.3 Plus
X 23542271 X 22212449..22212569 106..223 195 79.3 Plus
X 23542271 X 22217500..22217620 106..223 195 79.3 Plus
X 23542271 X 22226694..22226814 106..223 195 79.3 Plus
X 23542271 X 22231691..22231811 106..223 195 79.3 Plus
X 23542271 X 22236686..22236806 106..223 195 79.3 Plus
X 23542271 X 22241693..22241813 106..223 195 79.3 Plus
X 23542271 X 22246721..22246841 106..223 195 79.3 Plus
X 23542271 X 22251703..22251823 106..223 195 79.3 Plus
X 23542271 X 22163044..22163164 106..223 180 78.5 Plus
X 23542271 X 22172762..22172882 106..223 180 78.5 Plus
X 23542271 X 22177626..22177746 106..223 180 78.5 Plus
X 23542271 X 22182614..22182734 106..223 180 78.5 Plus
Blast to na_te.dros performed on 2014-11-27 00:46:45 has no hits.

BO29161.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-26 13:54:47 Download gff for BO29161.complete
Subject Subject Range Query Range Percent Splice Strand
CG6999-RA 57..803 17..765 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:33:43 Download gff for BO29161.complete
Subject Subject Range Query Range Percent Splice Strand
CG6999-RA 57..803 17..765 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:09:17 Download gff for BO29161.complete
Subject Subject Range Query Range Percent Splice Strand
CG6999-RA 57..803 17..765 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:09:17 Download gff for BO29161.complete
Subject Subject Range Query Range Percent Splice Strand
X 9088839..9089242 360..765 99   Plus
X 9088423..9088765 17..359 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:33:43 Download gff for BO29161.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 8982872..8983275 360..765 99   Plus
arm_X 8982456..8982798 17..359 100 -> Plus

BO29161.pep Sequence

Translation from 16 to 781

> BO29161.pep
MKKIINTSKPKRKSTSMKVEETKLDEARWGKPQTKEGESANGIANPSNDD
KKELANFKATFNSWAPEKKREKMHKVGVILISNIPKDMDGDCLKEIMNLH
SVVGRVYVQPETLSSFKTKKNMRKGWVEFISKSGAKKIALELNNKPITDG
KSSRFRGLLWKMKFLPRFKWYYLTDRMDYELAVCKVRVWSQARKRATFWY
DPDQMEYFKKQVKKMKKMKKVKEAEMATRNAEMAAKKAEMAAKKLKKSAA
SFLDH

BO29161.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:59:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG6999-PA 233 CG6999-PA 1..233 17..249 1222 100 Plus
CG32706-PA 230 CG32706-PA 1..230 17..249 1151 96.1 Plus
CG32708-PA 239 CG32708-PA 1..234 1..225 559 54.2 Plus
CG41562-PA 213 CG41562-PA 1..208 1..234 360 40.9 Plus
CG40813-PB 213 CG40813-PB 1..207 1..233 356 40.6 Plus