Clone BO29167 Report

Search the DGRC for BO29167

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:291
Well:67
Vector:pDNR-Dual
Associated Gene/TranscriptRip11-RB
Protein status:BO29167.pep: Imported from assembly
Sequenced Size:1261

Clone Sequence Records

BO29167.complete Sequence

1261 bp assembled on 2011-08-26

GenBank Submission: KX798232

> BO29167.complete
GAAGTTATCAGTCGACATGTGGAGTCCGACGCACTGTAGTGTAACGGTGC
AGCGAGCGCGTGGGCTGCTCACCAAGGGCAAGAATGGCACCAACAACTGC
TTCGTCACCATTGCTCTGGGCAAGGAGAAGTACCAGACGTCCGTCAAGGA
CAAGGCCGAGACGAGCGTCAACTGGAACGAGGAGTGCGAACTGAAAATTC
CCGATCAGGGTAATCGCGCCGAGCTCACTTTGACCTGCCTGCACAGGAAC
AATCTGGGCATCGATGAGTTCCTCGGCCAGGCGACGCTGCCGCTCAACGA
GATGGATGTGTATGACCGGCCACGCGCCAAGTGGTTCAAGCTGGAGAGCA
AGCCCGGCAAGGAGAAGAAGAACAAGGAGCGGGGCGAGCTGGAGGTGCGC
ATCGCCTTCGTGGTCAAGTCCGGCTCGCTGACCGATCTCAGCAAGAAGGA
CAAGCACAAGTCTTCCATTGGCCAGCTGGCCAGCTCCGTGGGTGGCAGTC
TGTTGTCCATCGGCAACGGCGAGAAGCGGCGAGGCATCAAGAAGCTGGCT
GGCTCGCTTAGCTCTAAGCTGCACATCCGTAGCAAGAAGAAGAACCAGGA
GGCGGGCGCCGACGATAGTAGCTCCTTCGGCGGCTCCTTCGCCAGCCTGG
GCACGCCCAACAGCTCCAACGGCAGGGGCCAGAATGGTGGCAGTGGCAGG
CGACGTGGCGGCCAGCGGGCGGGCGAAGCCGATCCCGGCGTGATCAGCGA
GGACGAGGACGAGTTTGTGTTCGACAACCTCTCGCACAAGAGCTCCGGCA
GCTCACTTAACATCCAACGCATCGGCCTGCAGCCGCCGCCAGTCGGTACG
CCCAACTTTACGCCGCGCCACCCATCGCCCCTGCTGAACAACGGAGTTAG
TGGCGTCGGAAGCGGCAGCGCGAAAGATAAATACAACAACGACAACGACA
GCAACTCGCCCAGTCCCAAGTCTACGGAGCGCATCATAATTGGTCACGAG
AAGTCGGGATCGCATGCGGATCGCCGCTCGGAGATATCCGCCCAGCTGGC
CAAGAAATACGAGGGCAAGTCGCGCGAGGAACTAATGCTAATTGCCAACG
GAATGGAGAACGAGGCTCTGCTGCAGCGGCAGCGCGTGAAGGAGCTGGAA
GACTATCTGGACAACCTGCTGCTGCGCGTGATGGAGACGCACCCGAAGAT
CCTGCAGAATCCGTATTCGCGCACCACGTCCGCCAAGAGCGGCGCAAGCT
TTCTAGACCAT

BO29167.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:47:01
Subject Length Description Subject Range Query Range Score Percent Strand
Rip11-RB 1230 CG6606-PB 1..1227 17..1243 6135 100 Plus
Rip11-RC 1263 CG6606-PC 1..1223 17..1239 6115 100 Plus
Rip11-RE 2448 CG6606-PE 1..914 17..930 4555 99.9 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:47:02
Subject Length Description Subject Range Query Range Score Percent Strand
Rip11-RB 2329 CG6606-RB 426..1655 14..1243 6150 100 Plus
Rip11-RC 2508 CG6606-RC 345..1570 14..1239 6130 100 Plus
Rip11-RE 3466 CG6606-RE 345..1261 14..930 4570 99.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 00:46:59
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 18639460..18640197 930..193 3675 99.9 Minus
X 23542271 X 18637413..18637575 1239..1077 815 100 Minus
X 23542271 X 18637634..18637788 1079..925 775 100 Minus
X 23542271 X 18640258..18640411 200..47 740 98.7 Minus
Blast to na_te.dros performed 2014-11-27 00:47:00
Subject Length Description Subject Range Query Range Score Percent Strand
rover 7318 rover ROVER 7318bp 1260..1298 923..961 114 76.9 Plus

BO29167.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-26 13:54:48 Download gff for BO29167.complete
Subject Subject Range Query Range Percent Splice Strand
Rip11-RB 344..1570 17..1245 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:33:51 Download gff for BO29167.complete
Subject Subject Range Query Range Percent Splice Strand
Rip11-RB 348..1574 17..1245 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:09:24 Download gff for BO29167.complete
Subject Subject Range Query Range Percent Splice Strand
Rip11-RB 429..1655 17..1245 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:09:24 Download gff for BO29167.complete
Subject Subject Range Query Range Percent Splice Strand
X 18647190..18647220 17..47 100   Minus
X 18640266..18640410 48..192 100 <- Minus
X 18639464..18640197 193..926 100 <- Minus
X 18637635..18637786 927..1078 100 <- Minus
X 18637404..18637573 1079..1245 97 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:33:51 Download gff for BO29167.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 18541223..18541253 17..47 100   Minus
arm_X 18534299..18534443 48..192 100 <- Minus
arm_X 18533497..18534230 193..926 100 <- Minus
arm_X 18531668..18531819 927..1078 100 <- Minus
arm_X 18531437..18531606 1079..1245 97 <- Minus

BO29167.pep Sequence

Translation from 16 to 1261

> BO29167.pep
MWSPTHCSVTVQRARGLLTKGKNGTNNCFVTIALGKEKYQTSVKDKAETS
VNWNEECELKIPDQGNRAELTLTCLHRNNLGIDEFLGQATLPLNEMDVYD
RPRAKWFKLESKPGKEKKNKERGELEVRIAFVVKSGSLTDLSKKDKHKSS
IGQLASSVGGSLLSIGNGEKRRGIKKLAGSLSSKLHIRSKKKNQEAGADD
SSSFGGSFASLGTPNSSNGRGQNGGSGRRRGGQRAGEADPGVISEDEDEF
VFDNLSHKSSGSSLNIQRIGLQPPPVGTPNFTPRHPSPLLNNGVSGVGSG
SAKDKYNNDNDSNSPSPKSTERIIIGHEKSGSHADRRSEISAQLAKKYEG
KSREELMLIANGMENEALLQRQRVKELEDYLDNLLLRVMETHPKILQNPY
SRTTSAKSGASFLDH

BO29167.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:59:44
Subject Length Description Subject Range Query Range Score Percent Strand
Rip11-PB 409 CG6606-PB 1..409 1..409 2111 100 Plus
Rip11-PC 420 CG6606-PC 1..414 1..414 2108 98.6 Plus
Rip11-PE 815 CG6606-PE 1..305 1..305 1578 99.7 Plus
Rip11-PD 826 CG6606-PD 1..305 1..305 1578 99.7 Plus
Rip11-PA 832 CG6606-PA 1..305 1..305 1578 99.7 Plus
Rip11-PE 815 CG6606-PE 706..815 300..409 545 97.3 Plus
Rip11-PD 826 CG6606-PD 706..820 300..414 542 92.2 Plus