Clone BO29175 Report

Search the DGRC for BO29175

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:291
Well:75
Vector:pDNR-Dual
Associated Gene/Transcriptyuri-RI
Protein status:BO29175.pep: Imported from assembly
Sequenced Size:814

Clone Sequence Records

BO29175.complete Sequence

814 bp assembled on 2011-08-26

GenBank Submission: KX797680

> BO29175.complete
GAAGTTATCAGTCGACATGGCCAGTCGCCAAGCCGGTTTCGTCCTAGACG
CCAAGTCCATGGGTCTGAATCCGTCGAGACCTGCATCATCGCCACCGCCA
CCACCATCATCTGCCAGTCAAATGTGTCGGCAAGTGCAGCCAACCGGAAC
GAGTGCCTCGCATCCACATCAAGAATCGACGCTAAAAGCCTCATCTCCTG
ATCGGTGCACTGCCAGCACCGAGGCGATGTCCACCGAACATTACCGCTGT
CTGATCCAGAAGCTGCGGGATACCAACGGCGATGCTGGCGATATGAGCTT
TGAGCTGAACAGCATATTTCTGAAGCGGCTGGACGAGATTGACTGCCTAG
ATGAGCACGAGGGTGATGACATGCACACTTGCCAGTTGCGTCTGGTCACT
TTTCAGGAGTGGGTGGATTTCCTGCTCCACGTGAACAGCGTGATCCTGGG
CAACGTGTCGGACTTGGAGAAGGAGGCGTACAGCAAGATCGTTGCCTGCT
GTCAGTCTGTCCAAGTGCGACAACAGCATACCCTCGAGGAGAATCGTAGG
CTGCGTGAGGACATTTGTGCGATCATAGAACGCGTGCAGCATTCTCCTCA
CTGCACCGACTTTGATTTCAATGGCATTTCCCTAGAGACACTGACCGTTA
ATCAATTGCGGGGCGTGGGAAAGGATCCCGCCCACGCGGAATGCGAGAGC
GAGAAGGTAGGCCATAGATCCTTGAAGGGAAAAGGCGGCGGTGATTCCAA
TGTCAAGTGGGACCCGAAGTCGTCCCACAAGCGCGAGAACTCTAAAGCAA
GCTTTCTAGACCAT

BO29175.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:47:42
Subject Length Description Subject Range Query Range Score Percent Strand
yuri-RI 783 CG31732-PI 1..780 17..796 3900 100 Plus
yuri-RQ 2946 CG31732-PQ 1..690 17..706 3450 100 Plus
yuri-RC 1737 CG31732-PC 1..690 17..706 3450 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:47:43
Subject Length Description Subject Range Query Range Score Percent Strand
yuri-RI 956 CG31732-RI 101..881 16..796 3905 100 Plus
yuri-RQ 3658 CG31732-RQ 566..1256 16..706 3455 100 Plus
yuri-RC 2555 CG31732-RC 566..1256 16..706 3455 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 00:47:40
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 15263242..15263665 796..373 2120 100 Minus
2L 23513712 2L 15263770..15264127 373..16 1790 100 Minus
Blast to na_te.dros performed on 2014-11-27 00:47:41 has no hits.

BO29175.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-26 13:54:49 Download gff for BO29175.complete
Subject Subject Range Query Range Percent Splice Strand
yuri-RI 102..881 17..798 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:34:15 Download gff for BO29175.complete
Subject Subject Range Query Range Percent Splice Strand
yuri-RI 102..881 17..798 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:09:48 Download gff for BO29175.complete
Subject Subject Range Query Range Percent Splice Strand
yuri-RI 102..881 17..798 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:09:48 Download gff for BO29175.complete
Subject Subject Range Query Range Percent Splice Strand
2L 15263770..15264126 17..373 100   Minus
2L 15263239..15263664 374..798 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:34:15 Download gff for BO29175.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 15263770..15264126 17..373 100   Minus
arm_2L 15263239..15263664 374..798 99 <- Minus

BO29175.pep Sequence

Translation from 16 to 814

> BO29175.pep
MASRQAGFVLDAKSMGLNPSRPASSPPPPPSSASQMCRQVQPTGTSASHP
HQESTLKASSPDRCTASTEAMSTEHYRCLIQKLRDTNGDAGDMSFELNSI
FLKRLDEIDCLDEHEGDDMHTCQLRLVTFQEWVDFLLHVNSVILGNVSDL
EKEAYSKIVACCQSVQVRQQHTLEENRRLREDICAIIERVQHSPHCTDFD
FNGISLETLTVNQLRGVGKDPAHAECESEKVGHRSLKGKGGGDSNVKWDP
KSSHKRENSKASFLDH

BO29175.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:59:48
Subject Length Description Subject Range Query Range Score Percent Strand
yuri-PI 260 CG31732-PI 1..260 1..260 1379 100 Plus
yuri-PC 578 CG31732-PC 1..241 1..239 1217 96.7 Plus
yuri-PB 890 CG31732-PB 1..241 1..239 1217 96.7 Plus
yuri-PQ 981 CG31732-PQ 1..241 1..239 1217 96.7 Plus
yuri-PD 564 CG31732-PD 1..227 15..239 1151 96.5 Plus