Clone BO29188 Report

Search the DGRC for BO29188

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:291
Well:88
Vector:pDNR-Dual
Associated Gene/TranscriptCG9572-RB
Protein status:BO29188.pep: Imported from assembly
Sequenced Size:1354

Clone Sequence Records

BO29188.complete Sequence

1354 bp assembled on 2011-08-26

GenBank Submission: KX798981

> BO29188.complete
GAAGTTATCAGTCGACATGCAGCTCCTGGTCGTGGCCCTGGTGGCGGTGG
CCATCGCGTCCTTGCCCCAACTGGCCGCAGGTAAAAAGCTGGGGAAGCGC
TGCGTGAACTGCACGTACCGCACTTACTACACCTACGGCGATGGGCGATC
CCTGCAGCGGGTTGTCTATAGAGATCCGGTCTACACACGTGCGCAGTCCT
ACGCGAGCGGATGCAGCGGTAGCCCGTGCGGCGTGAACGCCGTGTGCCAG
GAGGCCTCCGGAGGACGGCCCGTCTGCTCGTGCCCGCCCGGATTCAGCGG
TAATCCGCTCACCCACTGCAATCGCGGCGAGTGCCTGGACAACGTCGACT
GTCGCGACAACCTGCAGTGCAAGGACAATCGCTGCGTTAATCCCTGCGTG
GGTGCCTGTGGCATTGGCTCCAATTGTGACGCCCGCAACCACGTGGCCGT
GTGCAGCTGCCCCGCCGGCTACAATGGCGACCCATACCACGCCTGCCACC
TCAACGATCCGGAGGAGCAGTGCCATCCCAGTCCGTGCGGCGTTAACACC
AAGTGCGAGATCATCAACGGCGTGCCCACCTGCTCATGCGTTCACGGCTA
TGTGGGCAATCCGCTGAGCGGCTGTCGCCACGAGTGCGATCACGATGGCG
ACTGCAGCAGCCGGGACATGTGCTCCAGCAACTTCAAGTGCGTGCCGGCA
TGCGGGCAGTGCGGCACTGGCGCCACCTGCCGAACGGTCAGCAATCACCG
GGCTGTCTGCGAGTGCCCCAAGGGCTACATTGGCAGCCCGTACACGGAGT
GCCGACCGGAGTGCTATGGCGATGCCGACTGCCCGGCCGGGCGACCCGCC
TGCTTCTACGGCATCTGCAAGAACACCTGCGAGGGTGCCTGCGGCATCGG
CGCCGACTGCAACCTGCGCGGCCTCACACCCGTCTGCAGCTGCCCCCGCG
ACATGACCGGCGATCCCTTCGTGCGCTGCCGTCCCTTCACCAAGGAGGAC
CTTTGCGACCCCAATCCGTGCGGCACCAACGCCATCTGCGTGCCCGGACA
CGACAACACCGGCCGCGAGCGGCCCGTCTGCAACTGCCTGCCCGGCCACA
CCGGCAATCCGCTGAGCCACTGCACCCGGGGTGAGTGCCTGAGCAACAAC
GAGTGCCCCGACCATCGCGCCTGCATCAACTACCAGTGCATCGATCCCTG
CATCGGCAAGTGTGCCACTGGAGCCAGCTGCGAGCCCAAGGCCCACCTGG
CTGTCTGCCGCTGTCCACAGGGACAGTCGGGCGACGCCCTGGTGTCCTGT
CGCCAGACGCGCACCTTTCCCGTGGCCAAGTACCACGCAAGCTTTCTAGA
CCAT

BO29188.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:48:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG9572-RB 1323 CG9572-PB 1..1320 17..1336 6600 100 Plus
CG9572-RA 1326 CG9572-PA 6..1323 19..1336 6590 100 Plus
CG9572-RD 1215 CG9572-PD 67..1212 191..1336 5730 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:48:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG9572-RB 1664 CG9572-RB 136..1455 17..1336 6600 100 Plus
CG9572-RA 1667 CG9572-RA 141..1458 19..1336 6590 100 Plus
CG9572-RD 1556 CG9572-RD 202..1347 191..1336 5730 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 00:48:30
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 20154197..20154815 512..1130 3095 100 Plus
X 23542271 X 20150597..20150837 191..431 1205 100 Plus
X 23542271 X 20155098..20155305 1129..1336 1040 100 Plus
X 23542271 X 20150064..20150236 19..191 865 100 Plus
X 23542271 X 20150945..20151026 431..512 410 100 Plus
Blast to na_te.dros performed on 2014-11-27 00:48:31 has no hits.

BO29188.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-26 13:54:51 Download gff for BO29188.complete
Subject Subject Range Query Range Percent Splice Strand
CG9572-RB 134..1453 17..1338 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:34:45 Download gff for BO29188.complete
Subject Subject Range Query Range Percent Splice Strand
CG9572-RB 136..1455 17..1338 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:10:16 Download gff for BO29188.complete
Subject Subject Range Query Range Percent Splice Strand
CG9572-RB 136..1455 17..1338 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:10:16 Download gff for BO29188.complete
Subject Subject Range Query Range Percent Splice Strand
X 20155099..20155305 1130..1338 99   Plus
X 20154198..20154814 513..1129 100 -> Plus
X 20150945..20151026 431..512 100 -> Plus
X 20150598..20150836 192..430 100 -> Plus
X 20150063..20150236 17..191 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:34:45 Download gff for BO29188.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 20049132..20049338 1130..1338 99   Plus
arm_X 20048231..20048847 513..1129 100 -> Plus
arm_X 20044978..20045059 431..512 100 -> Plus
arm_X 20044631..20044869 192..430 100 -> Plus
arm_X 20044096..20044269 17..191 99 -> Plus

BO29188.pep Sequence

Translation from 16 to 1354

> BO29188.pep
MQLLVVALVAVAIASLPQLAAGKKLGKRCVNCTYRTYYTYGDGRSLQRVV
YRDPVYTRAQSYASGCSGSPCGVNAVCQEASGGRPVCSCPPGFSGNPLTH
CNRGECLDNVDCRDNLQCKDNRCVNPCVGACGIGSNCDARNHVAVCSCPA
GYNGDPYHACHLNDPEEQCHPSPCGVNTKCEIINGVPTCSCVHGYVGNPL
SGCRHECDHDGDCSSRDMCSSNFKCVPACGQCGTGATCRTVSNHRAVCEC
PKGYIGSPYTECRPECYGDADCPAGRPACFYGICKNTCEGACGIGADCNL
RGLTPVCSCPRDMTGDPFVRCRPFTKEDLCDPNPCGTNAICVPGHDNTGR
ERPVCNCLPGHTGNPLSHCTRGECLSNNECPDHRACINYQCIDPCIGKCA
TGASCEPKAHLAVCRCPQGQSGDALVSCRQTRTFPVAKYHASFLDH

BO29188.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:59:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG9572-PB 440 CG9572-PB 1..440 1..440 2574 100 Plus
CG9572-PA 441 CG9572-PA 3..441 2..440 2569 100 Plus
CG9572-PD 404 CG9572-PD 3..404 2..440 2314 91.6 Plus
dp-PZ 15998 CG33196-PZ 13030..13462 51..435 801 37.9 Plus
dp-PY 18095 CG33196-PY 15140..15559 66..435 799 38.1 Plus
dp-PZ 15998 CG33196-PZ 5698..6119 63..435 778 36.8 Plus
dp-PZ 15998 CG33196-PZ 12402..12824 66..436 774 36.6 Plus
dp-PZ 15998 CG33196-PZ 6553..6970 66..428 769 37.7 Plus
dp-PZ 15998 CG33196-PZ 8577..8992 66..429 765 36.8 Plus
dp-PZ 15998 CG33196-PZ 11126..11538 66..428 764 35.2 Plus
dp-PZ 15998 CG33196-PZ 6237..6645 66..429 758 36.3 Plus
dp-PZ 15998 CG33196-PZ 9852..10265 66..431 757 37 Plus
dp-PZ 15998 CG33196-PZ 7938..8353 66..428 753 35 Plus
dp-PZ 15998 CG33196-PZ 12727..13144 66..437 747 37.2 Plus
dp-PZ 15998 CG33196-PZ 13471..13890 66..432 744 36.3 Plus
dp-PZ 15998 CG33196-PZ 4946..5369 66..436 742 36.1 Plus
dp-PZ 15998 CG33196-PZ 7198..7609 66..428 742 37.2 Plus
dp-PZ 15998 CG33196-PZ 9071..9521 29..428 741 36 Plus
dp-PZ 15998 CG33196-PZ 8903..9319 66..442 739 34.6 Plus
dp-PZ 15998 CG33196-PZ 13367..13787 66..435 732 36.8 Plus
dp-PZ 15998 CG33196-PZ 7300..7723 66..438 731 33.9 Plus
dp-PZ 15998 CG33196-PZ 11450..11857 66..429 731 35.4 Plus
dp-PZ 15998 CG33196-PZ 13144..13562 59..428 730 36.5 Plus
dp-PZ 15998 CG33196-PZ 8157..8564 66..429 728 35.5 Plus
dp-PZ 15998 CG33196-PZ 4094..4519 66..440 726 34.9 Plus
dp-PZ 15998 CG33196-PZ 7377..7824 31..435 725 34.7 Plus
dp-PZ 15998 CG33196-PZ 9291..9740 32..436 725 34.6 Plus
dp-PZ 15998 CG33196-PZ 5375..5800 66..435 724 34.2 Plus
dp-PZ 15998 CG33196-PZ 10909..11323 62..428 724 35.5 Plus
dp-PZ 15998 CG33196-PZ 8784..9206 55..435 720 36.1 Plus
dp-PZ 15998 CG33196-PZ 9430..9842 66..432 720 36.3 Plus
dp-PZ 15998 CG33196-PZ 10382..10796 66..428 719 36.4 Plus
dp-PZ 15998 CG33196-PZ 6085..6540 19..428 717 33.7 Plus
dp-PZ 15998 CG33196-PZ 7832..8249 66..429 717 35 Plus
dp-PZ 15998 CG33196-PZ 4497..4932 42..428 713 34.4 Plus
dp-PZ 15998 CG33196-PZ 7627..8030 66..428 713 35.2 Plus
dp-PZ 15998 CG33196-PZ 4841..5258 66..435 712 35.7 Plus
dp-PZ 15998 CG33196-PZ 5594..6005 66..428 712 37 Plus
dp-PZ 15998 CG33196-PZ 5908..6328 60..428 711 36.9 Plus
dp-PZ 15998 CG33196-PZ 8016..8463 32..436 711 34.1 Plus
dp-PZ 15998 CG33196-PZ 11342..11751 66..430 709 36.4 Plus
dp-PZ 15998 CG33196-PZ 10174..10580 66..430 708 34.8 Plus
dp-PZ 15998 CG33196-PZ 12076..12498 54..432 706 33.8 Plus
dp-PZ 15998 CG33196-PZ 9540..9944 66..428 703 34.7 Plus
dp-PZ 15998 CG33196-PZ 10274..10684 66..428 700 36 Plus
dp-PZ 15998 CG33196-PZ 10486..10901 66..428 698 35 Plus
dp-PZ 15998 CG33196-PZ 5270..5695 66..436 697 35.7 Plus
dp-PZ 15998 CG33196-PZ 5476..5897 51..428 696 34.5 Plus
dp-PZ 15998 CG33196-PZ 13793..14171 66..435 695 37.7 Plus
dp-PZ 15998 CG33196-PZ 6986..7394 66..430 694 35.1 Plus
dp-PZ 15998 CG33196-PZ 12496..12923 50..430 693 36 Plus
dp-PZ 15998 CG33196-PZ 6648..7075 54..429 692 34 Plus
dp-PZ 15998 CG33196-PZ 6757..7179 54..428 692 35.3 Plus
dp-PZ 15998 CG33196-PZ 5052..5467 66..428 685 33.9 Plus