Clone BO29205 Report

Search the DGRC for BO29205

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:292
Well:5
Vector:pDNR-Dual
Associated Gene/TranscriptCG6012-RA
Protein status:BO29205.pep: Imported from assembly
Sequenced Size:958

Clone Sequence Records

BO29205.complete Sequence

958 bp assembled on 2011-09-14

GenBank Submission: KX796010

> BO29205.complete
GAAGTTATCAGTCGACATGTTCTGTGCCCTATCAGCATTCCTCACATTCG
TTGGTGTCTATGCCCTGTCCTCTTATCTCTACGAGCAGTTAAGAACGCCG
TACAAATTAATCAAAATCAGGTATTTCAGTGGGACTAGGCCAACTCTGAA
GGAGCGTTTCGGAGATTGGGCCGCTGTCACGGGTGCCAGCGATGGAATTG
GCAAGGAATATGCCAAGGAGCTGGCCCGCCAGAACATCAATGTGGTCCTA
ATCGCTAGAACCGAGGAGAAACTCCAGGCGGTTGCCAAGGAAATCGCGGA
TTGCGGTGCCGGTGTTCAGACCAAAATAGTGATAGCTGATTTTACCAAGG
GCTCGCAGGTCTATGAGCACATAGAAAAGGAAACTGCCAATATACCCATT
TCCATACTTGTAAACAACGTTGGAATCGCCACGCCGAAATCCTTGCTGAA
ATATAACCAGGAAGAAACGCAAAACATCATCGACACCAACGTGGTGGCCG
TTTCCCAGCTGTCTCGCATCTTCTTCCAGCGCATGAAGGCGTCTAAATTG
AAGGGAGCCATTGTGAATGTTGGTTCCGGCACGGAACTGCAGCCACTTCC
CAATGGAGCCTACTATGCCGCCTCCAAGGCGTACACCCGTAGTTTAACCC
TGGCCTTGTACCACGAGGCGAAGCCTTATGGCATCCATGTGCAGATGTTG
TCCCCGAACTTTGTGGTTACCAAAATCAACTCGTACTCCAGGCAGATCAT
GAAGGGTGGTCTCCTAATCCCATCGGCGTCGGCTTATGCCAAGAGTGCGG
TTAATCAGCTGCGGGACGAAGTGGACGAGACTCCTGGTTACCTGTGGCAC
CATGTCCAAAACGCTGTGGCCACCGCCTTCACCTGGCGAGTGCGAACCTA
TGTCGCCTGTAAATTGTTCAACAAAATATCCGACAATATAGCAAGCTTTC
TAGACCAT

BO29205.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:31:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG6012-RA 927 CG6012-PA 1..924 17..940 4620 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:31:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG6012-RA 1041 CG6012-RA 71..994 17..940 4620 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:31:54
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 16860076..16860606 940..410 2655 100 Minus
2L 23513712 2L 16861140..16861419 296..17 1400 100 Minus
2L 23513712 2L 16860673..16860787 410..296 575 100 Minus
Blast to na_te.dros performed on 2014-11-27 07:31:55 has no hits.

BO29205.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-14 12:05:42 Download gff for BO29205.complete
Subject Subject Range Query Range Percent Splice Strand
CG6012-RA 6..924 22..942 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:17:17 Download gff for BO29205.complete
Subject Subject Range Query Range Percent Splice Strand
CG6012-RA 76..994 22..942 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:12:31 Download gff for BO29205.complete
Subject Subject Range Query Range Percent Splice Strand
CG6012-RA 76..994 22..942 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:12:31 Download gff for BO29205.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16861140..16861414 22..296 100   Minus
2L 16860673..16860786 297..410 100 <- Minus
2L 16860072..16860605 411..942 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:17:17 Download gff for BO29205.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 16861140..16861414 22..296 100   Minus
arm_2L 16860673..16860786 297..410 100 <- Minus
arm_2L 16860072..16860605 411..942 99 <- Minus

BO29205.pep Sequence

Translation from 16 to 958

> BO29205.pep
MFCALSAFLTFVGVYALSSYLYEQLRTPYKLIKIRYFSGTRPTLKERFGD
WAAVTGASDGIGKEYAKELARQNINVVLIARTEEKLQAVAKEIADCGAGV
QTKIVIADFTKGSQVYEHIEKETANIPISILVNNVGIATPKSLLKYNQEE
TQNIIDTNVVAVSQLSRIFFQRMKASKLKGAIVNVGSGTELQPLPNGAYY
AASKAYTRSLTLALYHEAKPYGIHVQMLSPNFVVTKINSYSRQIMKGGLL
IPSASAYAKSAVNQLRDEVDETPGYLWHHVQNAVATAFTWRVRTYVACKL
FNKISDNIASFLDH

BO29205.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:18:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG6012-PA 308 CG6012-PA 1..308 1..308 1564 100 Plus
CG31809-PC 316 CG31809-PC 7..301 12..304 612 46 Plus
CG31809-PB 316 CG31809-PB 7..301 12..304 612 46 Plus
CG13284-PE 325 CG13284-PE 8..310 5..304 612 45.4 Plus
CG13284-PA 325 CG13284-PA 8..310 5..304 612 45.4 Plus