Clone BO29209 Report

Search the DGRC for BO29209

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:292
Well:9
Vector:pDNR-Dual
Associated Gene/TranscriptCG34462-RA
Protein status:BO29209.pep: Imported from assembly
Sequenced Size:970

Clone Sequence Records

BO29209.complete Sequence

970 bp assembled on 2011-09-14

GenBank Submission: KX794721

> BO29209.complete
GAAGTTATCAGTCGACATGGGACATTCGTCAAATTTGTTTTGGTTCTTTG
TTTTCGTATTAATCACAAAAGTATACGCCGCATTGTCCAATCCATTGTCA
TCAAAAATCGAAGTATACAATCAGCCTGAAGTTACACCCGAAAAAGAAAG
AGCCAAAGTGAGAAACTATTTCGTGCATGAGCCATACGGGCCCAACACAT
ATTCCTTTGGCTATGAGATTAATGATCCGCAGACGCAAAACTCTCAGTTT
CGAGAAGAAAAAAGATTTGTGAATGGCAGCATTCAAGGTAGCTACGGGTA
TGCAAGGCCAGATGGACGCATTGAAGTCACCAAATATATGGCGAAAGAGG
ATGGCGGTTACTCGGCCCAGATTCAGATTTTTAAAGCAGGCGATGAGAAA
GTCAAATCAGTTTGGCCCACCGAAAGACCTGATATATTAGTGGAGAGAAG
CAAATCCGATGCTCCTTCAAATATCACCTGGGATCCAAAGAGCCATCTCA
ACGTGACCGTCTCTCATGTGGCGGATCATGTGGCCCAGCAGCTGAAGCAG
CAACATGGCCTCGACCTAAACCACATCGATGTGACCAAGGATGTGCTTAA
ACCAGCGGTGCTCGATGTTATCCAGGGCAAGGAACCAACTAAGGGTCGCC
CTGTTCAGAATCTAATTCCTCAGCATTTTCCCATAGTTCCCTTCCAACTG
CCGGCGGATCAAGAAACCACCAAGGCCACCACAGCGGAGCCCCAGAAAAC
TGAAAGTTCAAAATACCACAGGGCGCAATCCAACAATGCCGAGAAGGCTC
AACAAGTCGAGGAGCCGGAGGCAAGATTACCGCCACCCGGGCCACTGGTC
AATAGCAGTCCAAGCGATGGAAATTGGCAACGGCGAACCATTGAGGCAAA
TCGCCGTGAATTCCTGGCCAATTTACCCAACCTAAGTGAGGCCAGGCCAG
AGGCAAGCTTTCTAGACCAT

BO29209.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:32:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG34462-RA 939 CG34462-PA 1..936 17..952 4680 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:32:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG34462-RA 1157 CG34462-RA 97..1033 16..952 4685 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:32:25
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 8329349..8330113 188..952 3825 100 Plus
3L 28110227 3L 8329160..8329299 50..189 700 100 Plus
Blast to na_te.dros performed on 2014-11-27 07:32:26 has no hits.

BO29209.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-14 12:05:43 Download gff for BO29209.complete
Subject Subject Range Query Range Percent Splice Strand
CG34462-RA 1..936 17..954 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:17:26 Download gff for BO29209.complete
Subject Subject Range Query Range Percent Splice Strand
CG34462-RA 98..1033 17..954 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:12:40 Download gff for BO29209.complete
Subject Subject Range Query Range Percent Splice Strand
CG34462-RA 98..1033 17..954 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:12:40 Download gff for BO29209.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8329350..8330113 189..954 99   Plus
3L 8329160..8329298 50..188 100 -> Plus
3L 8328680..8328712 17..49 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:17:26 Download gff for BO29209.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 8322450..8323213 189..954 99   Plus
arm_3L 8322260..8322398 50..188 100 -> Plus
arm_3L 8321780..8321812 17..49 100 -> Plus

BO29209.pep Sequence

Translation from 16 to 970

> BO29209.pep
MGHSSNLFWFFVFVLITKVYAALSNPLSSKIEVYNQPEVTPEKERAKVRN
YFVHEPYGPNTYSFGYEINDPQTQNSQFREEKRFVNGSIQGSYGYARPDG
RIEVTKYMAKEDGGYSAQIQIFKAGDEKVKSVWPTERPDILVERSKSDAP
SNITWDPKSHLNVTVSHVADHVAQQLKQQHGLDLNHIDVTKDVLKPAVLD
VIQGKEPTKGRPVQNLIPQHFPIVPFQLPADQETTKATTAEPQKTESSKY
HRAQSNNAEKAQQVEEPEARLPPPGPLVNSSPSDGNWQRRTIEANRREFL
ANLPNLSEARPEASFLDH

BO29209.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:18:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG34462-PA 312 CG34462-PA 1..312 1..312 1647 100 Plus