Clone BO29212 Report

Search the DGRC for BO29212

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:292
Well:12
Vector:pDNR-Dual
Associated Gene/TranscriptCG3117-RB
Protein status:BO29212.pep: Imported from assembly
Sequenced Size:1075

Clone Sequence Records

BO29212.complete Sequence

1075 bp assembled on 2011-08-26

GenBank Submission: KX794458

> BO29212.complete
GAAGTTATCAGTCGACATGTCGCGGTTGTGCACTTCTTTGGTCATCATTT
TGGGTCTCATCCTCTCGAGCGGTGGCACTCACATATGCCTGAGCTCCAAT
CTGTGTGTTCCCAGGGAAAATTGTCGTGAAGAGATGCCGTTCTTCGACTT
TAGTTCCACCATTGAGTGCTCCGACGAAGAAGTGTGCTGTGAAAAGTCAA
ATGTGATAGGCATGAGTAAGAGTCCTCCACAACATTCAGTGGACACACTT
CTTAGGACAAGTTATCCAAATGCCCTGGATGGAAGCCCTCAGGTGTTTGG
TGACCAAACCAAACCGAATCAATTTCCCTGGGTGACGGCTTTGTTCGCCA
AGGGATCTTATCTGGGAGGAGGATCTCTGATTACCCCAGGACTTGTACTA
ACCGCTGCCCACATCCTAGCGGGATTATCCCCCAATGACATCATGGTTAG
AGCTGGCGAATGGGATCTATCCTCCAGTGAGAAACTAAATCCACCGATGG
ATCGTCAAGTGATCAAGATCATGGAGCATGAGGCCTTTAACTACAGCAGC
GGAGCCAACGACTTGGCGCTTCTCTTCTTGGATTCGCCTTTTGAGTTGAG
GGCCAACATCCAGACCATTCGCTTACCCATTCCGGACAAGACTTTCGATC
GAAGGATATGCACGGTCGCAGGTTGGGGAATGAGATCGTCGACCGATGTT
GATATTCAGACCATCCAGCAGAAGGTCGATTTGCCCGTTGTCGAAAGTTC
CAAATGCCAGAGGCAGCTCAGACTAACTAAAATGGGCTCGAACTACCAGC
TGCCCGCCAGTTTAATGTGTGCCGGCGGTGAGGAGGGACGGGATGTCTGT
TCTCTATTCGGAGGATTCGCCCTTTTCTGCTCCCTGGACGATGATCCCAA
TCGCTACGAGCAGGCGGGCATCGTAAGCTTCGGCGTTGGATGCGGCCAGG
CAAACGTTCCGACCACCTTCACCCATGTGTCCAAGTTCATGGAGTGGATC
AATCCGCACTTGGAGCAAGTGCTTAGCGTGCCTGGAAATATGCTTCCTGC
CATGTCAGCAAGCTTTCTAGACCAT

BO29212.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:48:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG3117-RB 1044 CG3117-PB 1..1041 17..1057 5205 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:48:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG3117-RB 1217 CG3117-RB 16..1056 17..1057 5205 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 00:48:45
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2846087..2846939 1057..205 4265 100 Minus
2L 23513712 2L 2847004..2847197 210..17 955 99.5 Minus
Blast to na_te.dros performed on 2014-11-27 00:48:46 has no hits.

BO29212.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-26 13:54:52 Download gff for BO29212.complete
Subject Subject Range Query Range Percent Splice Strand
CG3117-RB 1..1041 17..1059 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:34:55 Download gff for BO29212.complete
Subject Subject Range Query Range Percent Splice Strand
CG3117-RB 16..1056 17..1059 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:10:23 Download gff for BO29212.complete
Subject Subject Range Query Range Percent Splice Strand
CG3117-RB 16..1056 17..1059 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:10:23 Download gff for BO29212.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2847009..2847197 17..205 100   Minus
2L 2846085..2846938 206..1059 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:34:55 Download gff for BO29212.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 2847009..2847197 17..205 100   Minus
arm_2L 2846085..2846938 206..1059 99 <- Minus

BO29212.pep Sequence

Translation from 16 to 1075

> BO29212.pep
MSRLCTSLVIILGLILSSGGTHICLSSNLCVPRENCREEMPFFDFSSTIE
CSDEEVCCEKSNVIGMSKSPPQHSVDTLLRTSYPNALDGSPQVFGDQTKP
NQFPWVTALFAKGSYLGGGSLITPGLVLTAAHILAGLSPNDIMVRAGEWD
LSSSEKLNPPMDRQVIKIMEHEAFNYSSGANDLALLFLDSPFELRANIQT
IRLPIPDKTFDRRICTVAGWGMRSSTDVDIQTIQQKVDLPVVESSKCQRQ
LRLTKMGSNYQLPASLMCAGGEEGRDVCSLFGGFALFCSLDDDPNRYEQA
GIVSFGVGCGQANVPTTFTHVSKFMEWINPHLEQVLSVPGNMLPAMSASF
LDH

BO29212.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:00:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG3117-PB 347 CG3117-PB 1..347 1..347 1829 100 Plus
CG14990-PA 322 CG14990-PA 51..303 82..334 659 47.8 Plus
SPH93-PA 494 CG6639-PA 250..486 96..332 606 49.2 Plus
CG18478-PA 294 CG18478-PA 36..293 84..341 591 45.3 Plus
CG31827-PA 294 CG31827-PA 36..293 84..341 591 45.3 Plus