Clone BO29226 Report

Search the DGRC for BO29226

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:292
Well:26
Vector:pDNR-Dual
Associated Gene/TranscriptRab27-RB
Protein status:BO29226.pep: Imported from assembly
Sequenced Size:742

Clone Sequence Records

BO29226.complete Sequence

742 bp assembled on 2011-09-14

GenBank Submission: KX796766

> BO29226.complete
GAAGTTATCAGTCGACATGCGTGCCGCGCCTCCTGAGCCTGAGCCTCTGC
AATTAGCCGGATCCGGTGAACAGTTCCTCGTCCTGGGCGACTCCGGCGTG
GGAAAGACCTGTCTCCTCTACCAGTACACGGATGGCCGGTTCCACACCCA
GTTCATCTCCACTGTGGGCATCGACTTCCGCGAAAAGCGGCTGCTGTACA
ACTCCCGCGGACGCCGCCACCGCATCCACCTGCAGATCTGGGACACCGCC
GGACAGGAGCGCTTCCGTTCACTAACCACGGCGTTTTACCGCGACGCCAT
GGGTTTCCTGCTCATCTTCGACCTGACCAGCGAGAAGAGCTTCCTGGAGA
CGGCCAACTGGCTGTCGCAGCTGCGGACGCACGCCTACTCCGAGGACCCC
GACGTGGTCCTCTGCGGCAACAAGTGCGACCTGCTGCAGCTGCGCGTGGT
GAGTCGCGACCAGGTGGCGGCCCTCTGCCGACGCTACCGGCTGCCGTACA
TCGAGACGAGCGCCTGCACCGGCGCCAACGTCAAGGAGGCCGTGGAGCTG
CTGGTTGGCCGGGTCATGGAGCGGATCGAGAACGCGGCCTGCAACCGCGA
GTTCTCCCTGCTACTGACCCAGTCGCGATGCCTGCCGAACATCGCCTACG
GTCAGCCGGAGGACCTGGTGCGCCTCCACGATCGGCGAGAGGAGCCCTGC
TCGCGGCGCAACTGCCGCAACTGTGCAAGCTTTCTAGACCAT

BO29226.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:32:40
Subject Length Description Subject Range Query Range Score Percent Strand
Rab27-RB 711 CG14791-PB 1..708 17..724 3540 100 Plus
Rab27-RC 693 CG14791-PC 38..690 72..724 3265 100 Plus
RabX4-RA 642 CG31118-PA 175..274 230..329 185 79 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:32:41
Subject Length Description Subject Range Query Range Score Percent Strand
Rab27-RB 1466 CG14791-RB 663..1370 17..724 3540 100 Plus
Rab27-RC 1564 CG14791-RC 816..1468 72..724 3265 100 Plus
Rab27-RC 1564 CG14791-RC 663..719 17..73 285 100 Plus
RabX4-RA 1416 CG31118-RA 625..724 230..329 185 79 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:32:37
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 1473980..1474511 724..193 2660 100 Minus
X 23542271 X 1474675..1474796 193..72 610 100 Minus
X 23542271 X 1476256..1476312 73..17 285 100 Minus
3R 32079331 3R 24827475..24827574 329..230 185 79 Minus
Blast to na_te.dros performed on 2014-11-27 07:32:38 has no hits.

BO29226.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-14 12:05:44 Download gff for BO29226.complete
Subject Subject Range Query Range Percent Splice Strand
Rab27-RB 619..1326 17..726 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:17:30 Download gff for BO29226.complete
Subject Subject Range Query Range Percent Splice Strand
Rab27-RB 619..1326 17..726 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:12:44 Download gff for BO29226.complete
Subject Subject Range Query Range Percent Splice Strand
Rab27-RB 663..1370 17..726 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:12:44 Download gff for BO29226.complete
Subject Subject Range Query Range Percent Splice Strand
X 1476256..1476312 17..73 100   Minus
X 1474675..1474794 74..193 100 <- Minus
X 1473978..1474510 194..726 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:17:30 Download gff for BO29226.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 1370289..1370345 17..73 100   Minus
arm_X 1368708..1368827 74..193 100 <- Minus
arm_X 1368011..1368543 194..726 99 <- Minus

BO29226.pep Sequence

Translation from 16 to 742

> BO29226.pep
MRAAPPEPEPLQLAGSGEQFLVLGDSGVGKTCLLYQYTDGRFHTQFISTV
GIDFREKRLLYNSRGRRHRIHLQIWDTAGQERFRSLTTAFYRDAMGFLLI
FDLTSEKSFLETANWLSQLRTHAYSEDPDVVLCGNKCDLLQLRVVSRDQV
AALCRRYRLPYIETSACTGANVKEAVELLVGRVMERIENAACNREFSLLL
TQSRCLPNIAYGQPEDLVRLHDRREEPCSRRNCRNCASFLDH

BO29226.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:18:12
Subject Length Description Subject Range Query Range Score Percent Strand
Rab27-PB 236 CG14791-PB 1..236 1..236 1245 100 Plus
Rab27-PC 230 CG14791-PC 13..230 19..236 1147 99.5 Plus
Rab8-PC 207 CG8287-PC 10..174 19..188 389 44.7 Plus
Rab8-PA 207 CG8287-PA 10..174 19..188 389 44.7 Plus
Rab10-PA 204 CG17060-PA 11..173 19..186 387 44 Plus