Clone BO29228 Report

Search the DGRC for BO29228

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:292
Well:28
Vector:pDNR-Dual
Associated Gene/TranscriptPect-RB
Protein status:BO29228.pep: Imported from assembly
Sequenced Size:1213

Clone Sequence Records

BO29228.complete Sequence

1213 bp assembled on 2011-08-26

GenBank Submission: KX794639

> BO29228.complete
GAAGTTATCAGTCGACATGGAGGCAAATGGCGATACCAGCGCCTGCAATG
GGTATTCGGACAAGCAGCGGAAGGATGTGCGCGTCTGGTGCGATGGATGC
TATGATATGGTACACTTCGGACATGCCAATTCTCTGCGACAAGCCAAGGC
TCTTGGCGATAAGGTAATTGTGGGCATTCACACCGACGAGGAGATCACCA
AGCACAAGGGACCACCGGTCTTCACCGAGGAGGAGCGCGTCAAGATGGTC
AAGGGCATCAAATGGGTGGATGAGGTGGTGCTCGGTGCTCCGTATGTGAC
CACACTGGATGTGCTCGACCAGAACAACTGTGATTTCTGTGTGCATGGAG
ATGACATTACAATGACAGCCGAAGGAGTGGACACATATCATTTGGTCAAA
TCAGCCAATCGCTACAAGGAAGTGAAACGCACAGCTGGAGTCTCGACCAC
TGACCTTGTGGGCCGCATGTTGCTCCTGACACGCAACCACTTCCGTCAAG
GATCCGCGGAATATGATATCGAGAAAGAAGTGTCAATTTTAAAACGACAA
ATAAAATCCCATCCAGGTTCTTCGAACATGGGTCAAGATTCGGCAGCCAA
AAGTCCGTGGACCGGTTGTAGTCAGTTCTTGCCGACTACCCAAAAGATCA
TACAGTTCAGTGATGGAAAGTCACCGAATCCCGGCGATAAGATTGTTTAT
GTGGCTGGCGCCTTCGATCTCTTCCATGTGGGTCACCTGGACTTTCTGGA
AAAGGCTAAGAAACTGGGTGACTATCTGATTGTTGGCCTGCACACAGATC
CCGTGGTGAACTCCTACAAGGGCAGCAACTATCCCATTATGAATCTGCAC
GAGCGCGTGCTCAGTGTTTTGGCCTGCAAGTTTGTCAATGAGGTAGTAAT
CGGAGCTCCCTACTGTGTCACTGAAGAGCTGCTTGAGCACTTCAAAATCG
ATGTTGTCTGTCATGGACGCACACCCATTGCGCTTGAGAATGGCAAGATC
GATCCATATGCCGTTCCCAAGACGCGAGCCATCTTTGAGCTGATCGATTC
CGGCAACGAGATGACCACGGAGCGCATCGTGGAGCGCATCATCTCGCACC
GACTGGAATATGAGCGTCGCAATCAGGCCAAAGAAAAGAAGGAAATCGAA
GCCTTTGAGGCACTTCAACGCCAAAAACAGACCCAAAAGGCCGGCGCAAG
CTTTCTAGACCAT

BO29228.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:49:11
Subject Length Description Subject Range Query Range Score Percent Strand
Pect-RB 1182 CG5547-PB 1..1179 17..1195 5895 100 Plus
Pect-RD 1146 CG5547-PD 513..1143 565..1195 3155 100 Plus
Pect-RC 1125 CG5547-PC 512..1122 585..1195 3055 100 Plus
Pect-RD 1146 CG5547-PD 1..514 17..530 2570 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:49:12
Subject Length Description Subject Range Query Range Score Percent Strand
Pect-RB 2210 CG5547-RB 429..1607 17..1195 5895 100 Plus
Pect-RD 2174 CG5547-RD 941..1571 565..1195 3155 100 Plus
Pect-RC 2153 CG5547-RC 940..1550 585..1195 3055 100 Plus
Pect-RD 2174 CG5547-RD 429..942 17..530 2570 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 00:49:09
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 13209909..13210225 879..1195 1585 100 Plus
2L 23513712 2L 13208109..13208360 99..350 1260 100 Plus
2L 23513712 2L 13209660..13209845 695..880 930 100 Plus
2L 23513712 2L 13209429..13209601 524..696 850 99.4 Plus
2L 23513712 2L 13208665..13208777 418..530 565 100 Plus
2L 23513712 2L 13204190..13204272 17..99 415 100 Plus
2L 23513712 2L 13208419..13208488 349..418 350 100 Plus
Blast to na_te.dros performed on 2014-11-27 00:49:10 has no hits.

BO29228.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-26 13:54:52 Download gff for BO29228.complete
Subject Subject Range Query Range Percent Splice Strand
Pect-RB 423..1601 17..1197 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:35:10 Download gff for BO29228.complete
Subject Subject Range Query Range Percent Splice Strand
Pect-RB 429..1607 17..1197 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:10:37 Download gff for BO29228.complete
Subject Subject Range Query Range Percent Splice Strand
Pect-RB 429..1607 17..1197 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:10:37 Download gff for BO29228.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13209911..13210225 881..1197 99   Plus
2L 13209660..13209845 695..880 100 -> Plus
2L 13209436..13209599 531..694 100 -> Plus
2L 13208665..13208777 418..530 100 -> Plus
2L 13208421..13208487 351..417 100 -> Plus
2L 13208110..13208360 100..350 100 -> Plus
2L 13204190..13204272 17..99 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:35:10 Download gff for BO29228.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 13209911..13210225 881..1197 99   Plus
arm_2L 13209660..13209845 695..880 100 -> Plus
arm_2L 13209436..13209599 531..694 100 -> Plus
arm_2L 13208665..13208777 418..530 100 -> Plus
arm_2L 13208421..13208487 351..417 100 -> Plus
arm_2L 13208110..13208360 100..350 100 -> Plus
arm_2L 13204190..13204272 17..99 100 -> Plus

BO29228.pep Sequence

Translation from 16 to 1213

> BO29228.pep
MEANGDTSACNGYSDKQRKDVRVWCDGCYDMVHFGHANSLRQAKALGDKV
IVGIHTDEEITKHKGPPVFTEEERVKMVKGIKWVDEVVLGAPYVTTLDVL
DQNNCDFCVHGDDITMTAEGVDTYHLVKSANRYKEVKRTAGVSTTDLVGR
MLLLTRNHFRQGSAEYDIEKEVSILKRQIKSHPGSSNMGQDSAAKSPWTG
CSQFLPTTQKIIQFSDGKSPNPGDKIVYVAGAFDLFHVGHLDFLEKAKKL
GDYLIVGLHTDPVVNSYKGSNYPIMNLHERVLSVLACKFVNEVVIGAPYC
VTEELLEHFKIDVVCHGRTPIALENGKIDPYAVPKTRAIFELIDSGNEMT
TERIVERIISHRLEYERRNQAKEKKEIEAFEALQRQKQTQKAGASFLDH

BO29228.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:00:05
Subject Length Description Subject Range Query Range Score Percent Strand
Pect-PB 393 CG5547-PB 1..393 1..393 2072 100 Plus
Pect-PD 381 CG5547-PD 1..381 1..393 1990 96.9 Plus
Pect-PC 374 CG5547-PC 1..374 1..393 1947 95.2 Plus
Pect-PE 371 CG5547-PE 1..371 1..393 1930 94.4 Plus
Cct2-PA 381 CG18330-PA 74..234 16..174 229 36.4 Plus