Clone BO29230 Report

Search the DGRC for BO29230

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:292
Well:30
Vector:pDNR-Dual
Associated Gene/TranscriptCG16758-RE
Protein status:BO29230.pep: Imported from assembly
Sequenced Size:997

Clone Sequence Records

BO29230.complete Sequence

997 bp assembled on 2011-08-26

GenBank Submission: KX797652

> BO29230.complete
GAAGTTATCAGTCGACATGTGTAACGCCAATTGCTGTTCGAATCCCAAAG
GCAAGGCTGGCACCAAAACCGCCATCAATAATACAAATTGGCCAGATATC
ATACCAACTCCAGAAAGTCTGCTGTATCCCTATGAGGTCATCGAGGAGAT
CGCCGACTTCATTACCAAGGGGTCCGGCATGCGCCCCAAGATCGGCATCA
TCTGCGGCTCTGGGCTAGGCTCATTGGCCGATATGATCCAGGACCCGAAG
ATCTTCGAGTATGAGAAGATCCCCAACTTCCCGGTATCTACAGTTGAGGG
CCATGCCGGACGACTGGTGGTCGGCACACTCGAGGGCGCCACTGTGATGG
CGATGCAGGGCAGGTTCCACTTCTACGAGGGCTATCCGCTGGCCAAGTGC
TCAATGCCGGTTCGCGTGATGAAGCTGTGCGGTGTGGAATACCTGTTCGC
CACCAATGCGGCTGGTGGAATCAATCCACGGTTCGCGGTGGGCGACATCA
TGCTGATGCATGACCATGTCAACATGCTGGGCTTTGCCGGAAATTCTCCG
CTCCAGGGACCCAATGACCCACGCTTCGGACCCCGCTTTCCCGCCCTGGT
GAACTCGTACAACAAGGACCTAATCAACAAGGCCATCGAGATCGCCAAGG
CCATGGGCATAGAGTCCAACATTCACGTCGGCGTATACTCCTGTCTGGGT
GGTCCCAACTACGAGACCATCGCCGAGCTGAAGGCCCTGCGCATGATGGG
CGTGGATGCGGTGGGCATGTCCACCGTACATGAGGTCATCACTGCACGGC
ACTGCGACATGAAGGTATTCGCCTTCAGCCTCATCACAAATAAGTGCGCC
ACCGAGTACAGCGATAAGAAGGACGATGAGGCCAACCACGATGAGGTTAT
GGCTGTGGCCAAGAACAGGCAAAAGGCCTGCTGCGAACTGGTCTCCCGAC
TCATCCGGGAAATCCACTTGGCATCCGCTGCAAGCTTTCTAGACCAT

BO29230.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:51:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG16758-RE 966 CG16758-PE 1..963 17..979 4815 100 Plus
CG16758-RG 1119 CG16758-PG 235..1116 98..979 4350 99.5 Plus
CG16758-RF 987 CG16758-PF 103..984 98..979 4350 99.5 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:51:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG16758-RE 1449 CG16758-RE 319..1281 17..979 4815 100 Plus
CG16758-RG 1617 CG16758-RG 568..1449 98..979 4350 99.5 Plus
CG16758-RF 1245 CG16758-RF 196..1077 98..979 4350 99.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 00:51:51
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 2499689..2500462 897..124 3870 100 Minus
3L 28110227 3L 2502388..2502497 126..17 550 100 Minus
3L 28110227 3L 2499540..2499625 979..894 430 100 Minus
Blast to na_te.dros performed on 2014-11-27 00:51:52 has no hits.

BO29230.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-26 15:54:22 Download gff for BO29230.complete
Subject Subject Range Query Range Percent Splice Strand
CG16758-RE 319..1281 17..981 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:36:35 Download gff for BO29230.complete
Subject Subject Range Query Range Percent Splice Strand
CG16758-RE 319..1281 17..981 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:11:52 Download gff for BO29230.complete
Subject Subject Range Query Range Percent Splice Strand
CG16758-RE 319..1281 17..981 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:11:52 Download gff for BO29230.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2502391..2502497 17..123 100   Minus
3L 2499691..2500462 124..895 100 <- Minus
3L 2499538..2499623 896..981 97 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:36:35 Download gff for BO29230.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 2502391..2502497 17..123 100   Minus
arm_3L 2499691..2500462 124..895 100 <- Minus
arm_3L 2499538..2499623 896..981 97 <- Minus

BO29230.pep Sequence

Translation from 16 to 997

> BO29230.pep
MCNANCCSNPKGKAGTKTAINNTNWPDIIPTPESLLYPYEVIEEIADFIT
KGSGMRPKIGIICGSGLGSLADMIQDPKIFEYEKIPNFPVSTVEGHAGRL
VVGTLEGATVMAMQGRFHFYEGYPLAKCSMPVRVMKLCGVEYLFATNAAG
GINPRFAVGDIMLMHDHVNMLGFAGNSPLQGPNDPRFGPRFPALVNSYNK
DLINKAIEIAKAMGIESNIHVGVYSCLGGPNYETIAELKALRMMGVDAVG
MSTVHEVITARHCDMKVFAFSLITNKCATEYSDKKDDEANHDEVMAVAKN
RQKACCELVSRLIREIHLASAASFLDH

BO29230.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:00:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG16758-PE 321 CG16758-PE 1..321 1..321 1699 100 Plus
CG16758-PF 328 CG16758-PF 1..328 1..321 1561 91.8 Plus
CG16758-PG 372 CG16758-PG 45..372 1..321 1561 91.8 Plus
CG16758-PH 396 CG16758-PH 45..396 1..321 1526 85.6 Plus
CG16758-PD 329 CG16758-PD 12..329 3..321 1507 92.2 Plus