Clone BO29232 Report

Search the DGRC for BO29232

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:292
Well:32
Vector:pDNR-Dual
Associated Gene/TranscriptFib-RA
Protein status:BO29232.pep: Imported from assembly
Sequenced Size:1066

Clone Sequence Records

BO29232.complete Sequence

1066 bp assembled on 2011-09-14

GenBank Submission: KX798979

> BO29232.complete
GAAGTTATCAGTCGACATGGGCAAACCAGGATTCAGTCCACGCGGTGGTG
GCGGCGGCGGCGGAGGAGGAGGAGGTGGATTCCGTGGGCGTGGTGGCGGC
GGCGGCGGAGGAGGCGGTGGATTTGGAGGCGGCCGTGGACGCGGTGGCGG
CGGCGATCGCGGTGGCCGTGGAGGATTCGGTGGTGGCCGTGGAGGAGGTG
GTCGCGGTGGTGGTGGCGGCGGCGGCCGTGGTGCCTTCGGAGGACGTGGC
GGCGGCGGTGGTCGCGGTGGCGGCGGCCGTGGAGGCGGTGGTCGCGGCGG
AGGAGGACGTGGTGGTGGTGCTGGCGGCTTCAAGGGCGGCAAGACCGTCA
CCATCGAGCCGCATCGTCACGAGGGAGTGTTCATTGCGCGCGGCAAGGAG
GACGCTCTGGTCACCAGGAACTTTGTACCTGGATCCGAAGTCTACGGCGA
GAAGCGCATCTCCGTTGAGACCAATGGCGAGAAGATTGAGTACCGCGTGT
GGAATCCCTTCCGCTCCAAGCTGGCTGCCGCCGTTCTGGGTGGCGTCGAG
CAGATTCACATGCCGCCGGGCTCGAAGGTTCTCTACCTGGGCGCCGCCTC
CGGAACGACAGTCTCGCATGTGTCCGATGTGGTGGGACCCGAGGGCCTGG
TCTACGCCGTGGAGTTCTCACACCGATCCGGTCGCGATCTGATCAACGTG
GCCAAGAAGCGCACCAACATCATACCCATCATCGAGGACGCTCGCCATCC
ACACAAGTACCGCATGCTGGTGGGCATGGTGGACACCATCTTCGCCGACG
TTGCCCAGCCGGATCAGGGCCGCATTGTGGCGCTGAATGCCCAGCACTTC
CTGAAGAACGGCGGACACTTTGTCATCTCGATCAAGGCCTCCTGCATCGA
CTCGACGGCGCAGCCCGAAGCGGTATTCGCTGCCGAGGTGAAGAAGATGC
AGGCGGACAAGCTGAAGCCCCAAGAGCAGCTCACGCTGGAGCCCTACGAG
CGAGACCACGCCGTTGTCGTTGGCGTCTACCGACCACCGCCCAAGCAGGC
AAGCTTTCTAGACCAT

BO29232.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:33:03
Subject Length Description Subject Range Query Range Score Percent Strand
Fib-RA 1035 CG9888-PA 1..1032 17..1048 5160 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:33:05
Subject Length Description Subject Range Query Range Score Percent Strand
Fib-RA 1318 CG9888-RA 132..1163 17..1048 5160 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:33:00
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 23073064..23073644 1048..468 2905 100 Minus
2R 25286936 2R 23074024..23074466 469..27 2215 100 Minus
Blast to na_te.dros performed on 2014-11-27 07:33:01 has no hits.

BO29232.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-14 12:05:44 Download gff for BO29232.complete
Subject Subject Range Query Range Percent Splice Strand
Fib-RA 127..1158 17..1050 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:17:38 Download gff for BO29232.complete
Subject Subject Range Query Range Percent Splice Strand
Fib-RA 132..1163 17..1050 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:12:50 Download gff for BO29232.complete
Subject Subject Range Query Range Percent Splice Strand
Fib-RA 132..1163 17..1050 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:12:50 Download gff for BO29232.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23074024..23074466 27..469 100   Minus
2R 23073062..23073642 470..1050 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:17:38 Download gff for BO29232.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 18961547..18961989 27..469 100   Minus
arm_2R 18960585..18961165 470..1050 99 <- Minus

BO29232.pep Sequence

Translation from 16 to 1066

> BO29232.pep
MGKPGFSPRGGGGGGGGGGGGFRGRGGGGGGGGGGFGGGRGRGGGGDRGG
RGGFGGGRGGGGRGGGGGGGRGAFGGRGGGGGRGGGGRGGGGRGGGGRGG
GAGGFKGGKTVTIEPHRHEGVFIARGKEDALVTRNFVPGSEVYGEKRISV
ETNGEKIEYRVWNPFRSKLAAAVLGGVEQIHMPPGSKVLYLGAASGTTVS
HVSDVVGPEGLVYAVEFSHRSGRDLINVAKKRTNIIPIIEDARHPHKYRM
LVGMVDTIFADVAQPDQGRIVALNAQHFLKNGGHFVISIKASCIDSTAQP
EAVFAAEVKKMQADKLKPQEQLTLEPYERDHAVVVGVYRPPPKQASFLDH

BO29232.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:18:21
Subject Length Description Subject Range Query Range Score Percent Strand
Fib-PA 344 CG9888-PA 1..344 1..344 1844 100 Plus
CG10909-PA 349 CG10909-PA 109..342 108..338 526 46.6 Plus
Cpr47Ef-PC 612 CG13214-PC 337..484 2..108 322 53.4 Plus
Cpr47Ef-PC 612 CG13214-PC 286..419 2..108 321 55.2 Plus
Cpr47Ef-PD 601 CG13214-PD 286..419 2..108 321 55.2 Plus
Cpr47Ef-PD 601 CG13214-PD 337..475 2..107 321 53.2 Plus
Cpr47Ef-PC 612 CG13214-PC 240..361 2..108 315 54.9 Plus
Cpr47Ef-PD 601 CG13214-PD 240..361 2..108 315 54.9 Plus
Cpr47Ef-PC 612 CG13214-PC 237..354 5..108 314 57 Plus
Cpr47Ef-PC 612 CG13214-PC 366..519 2..108 314 51.3 Plus
Cpr47Ef-PD 601 CG13214-PD 237..354 5..108 314 57 Plus
Cpr47Ef-PC 612 CG13214-PC 331..454 2..108 313 58.7 Plus
Cpr47Ef-PD 601 CG13214-PD 331..454 2..108 313 58.7 Plus
Cpr47Ef-PC 612 CG13214-PC 256..388 2..108 305 55.6 Plus
Cpr47Ef-PC 612 CG13214-PC 432..551 2..108 305 61.2 Plus
Cpr47Ef-PD 601 CG13214-PD 256..388 2..108 305 55.6 Plus
Cpr47Ef-PD 601 CG13214-PD 369..508 2..108 304 54.6 Plus
TwdlT-PA 286 CG5812-PA 25..134 3..116 304 58.5 Plus
Cpr47Ef-PD 601 CG13214-PD 432..540 2..108 303 64 Plus
Cpr47Ef-PD 601 CG13214-PD 366..515 2..108 300 49.7 Plus
Cpr47Ef-PD 601 CG13214-PD 399..530 2..104 299 53 Plus
Cpr47Ef-PC 612 CG13214-PC 301..424 2..108 294 56.5 Plus
Cpr47Ef-PD 601 CG13214-PD 301..424 2..108 294 56.5 Plus
Cpr47Ef-PC 612 CG13214-PC 235..332 10..108 291 62.7 Plus
Cpr47Ef-PD 601 CG13214-PD 235..332 10..108 291 62.7 Plus
Cpr47Ef-PC 612 CG13214-PC 399..526 2..108 290 53.9 Plus
Cpr47Ef-PC 612 CG13214-PC 419..541 10..104 283 53.7 Plus
Cpr47Ef-PC 612 CG13214-PC 468..590 2..115 250 49.6 Plus
Cpr47Ef-PC 612 CG13214-PC 459..573 2..107 248 51.7 Plus
Cpr47Ef-PD 601 CG13214-PD 459..579 2..115 239 49.6 Plus
Cpr47Ef-PC 612 CG13214-PC 35..175 10..158 234 41.7 Plus
Cpr47Ef-PD 601 CG13214-PD 35..175 10..158 234 41.7 Plus
Cpr47Ef-PC 612 CG13214-PC 462..602 2..101 223 46.5 Plus
Cpr47Ef-PD 601 CG13214-PD 481..591 2..101 213 50 Plus
Cpr47Ef-PC 612 CG13214-PC 45..125 4..81 197 56.1 Plus
Cpr47Ef-PD 601 CG13214-PD 45..125 4..81 197 56.1 Plus