Clone BO29246 Report

Search the DGRC for BO29246

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:292
Well:46
Vector:pDNR-Dual
Associated Gene/TranscriptCG13384-RD
Protein status:BO29246.pep: Imported from assembly
Sequenced Size:1483

Clone Sequence Records

BO29246.complete Sequence

1483 bp assembled on 2011-08-26

GenBank Submission: KX797316

> BO29246.complete
GAAGTTATCAGTCGACATGACGGAACGACAGCCGTTGCTCCTCCAGAGCG
ATGCCTCTGACTACGAGGGCAGTCGAGGATCGGCAGCACGACCCGTGCGC
AGCTCTCCGCCGGACAACACTCTCGTCAACGTGCACAGCGAGGACAGCTT
AGCAGCAGCCTCTGGATCGGGAGATGATGAAATTGGATCGACGGATAAGT
CCTATAACCCCACCCATCATCGCGACCTGGAGCATCCGACGTCCAACTTC
GATACCCTGGTTCATCTGCTGAAGGGCAACATTGGTACGGGCATTCTGGC
AATGCCGGATGCCTTTAAGAACGCCGGACTTTATGTGGGACTCTTTGGCA
CAATGATCATGGGAGCCATCTGCACCCACTGCATGCACATGCTGGTCAAC
TGCTCCCACGAGCTGTGCCGGAGATTCCAGCAGCCATCGTTAGATTTCTC
GGAGGTGGCATACTGCAGTTTTGAGTCGGGACCTTTGGGACTAAGACGAT
ACTCCATGTTGGCTCGACGAATTGTTACCACGTTCTTGTTTATCACGCAA
ATCGGTTTCTGCTGCGTCTACTTCCTCTTTGTGGCGTTGAATATCAAGGA
CGTTATGGATCACTACTACAAGATGCCTGTGCAGATTTACCTGCTTATAA
TGCTTGGACCCATGATCCTGTTGAATCTGGTGCGGAATCTGAAGTATTTG
ACACCCGTTTCGCTGGTTGCCGCCCTGCTCACAGTTGCCGGACTGGCCAT
TACATTCTCGTACATGCTGGTGGATCTGCCGGATGTGCACACGGTCAAGC
CGGTGGCCACTTGGGCGACGTTGCCTCTATATTTTGGAACCGCCATCTAC
GCGTTCGAGGGAATTGGTGTTGTCCTGCCCTTGGAGAACAATATGCGCAC
ACCCGAGGACTTTGGCGGCACCACAGGTGTCCTCAACACGGGCATGGTGA
TCGTGGCCTGCTTGTACACAGCTGTCGGGTTCTTCGGCTACCTGAAGTAC
GGCGAACACGTGGAGGGCAGCATTACCCTAAATCTGCCGCAAGGCGACAC
ACTTTCCCAGTTGGTGCGGATTTCAATGGCGGTGGCCATCTTCCTCTCGT
ATACGCTTCAGTTTTATGTGCCTGTGAACATCGTGGAACCCTTTGTGCGA
AGTCATTTCGATACAACGAGGGCCAAGGATTTGTCAGCAACTGTGCTGCG
AGTTGTTCTGGTCACTTTTACCTTCCTGCTGGCCACCTGTATTCCCAATC
TAGGCTCCATTATCTCGCTGGTAGGAGCCGTCAGCAGCTCAGCTTTGGCC
CTAATTGCACCACCCATAATTGAAGTTATTACATTTTACAACGTTGGCTA
TGGACGCTTCAATTGGATGCTATGGAAGGACGTTTTAATCCTGATCTTTG
GACTCTGTGGCTTTGTGTTTGGCACCTGGGCCAGCTTAGCTCAAATCCTG
AACGACAGAACCCACGCAAGCTTTCTAGACCAT

BO29246.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:49:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG13384-RI 1452 CG13384-PI 1..1449 17..1465 7185 99.7 Plus
CG13384-RH 1452 CG13384-PH 1..1449 17..1465 7185 99.7 Plus
CG13384-RF 1452 CG13384-PF 1..1449 17..1465 7185 99.7 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:49:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG13384-RI 2510 CG13384-RI 390..1838 17..1465 7185 99.7 Plus
CG13384-RH 2560 CG13384-RH 440..1888 17..1465 7185 99.7 Plus
CG13384-RF 2534 CG13384-RF 414..1862 17..1465 7185 99.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 00:49:52
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8386480..8387378 152..1050 4465 99.8 Plus
2L 23513712 2L 8387891..8388132 1224..1465 1195 99.6 Plus
2L 23513712 2L 8387659..8387831 1051..1223 850 99.4 Plus
2L 23513712 2L 8386247..8386385 17..155 695 100 Plus
Blast to na_te.dros performed on 2014-11-27 00:49:53 has no hits.

BO29246.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-26 13:54:53 Download gff for BO29246.complete
Subject Subject Range Query Range Percent Splice Strand
CG13384-RD 549..1997 17..1467 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:35:33 Download gff for BO29246.complete
Subject Subject Range Query Range Percent Splice Strand
CG13384-RF 414..1862 17..1467 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:10:57 Download gff for BO29246.complete
Subject Subject Range Query Range Percent Splice Strand
CG13384-RF 414..1862 17..1467 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:10:57 Download gff for BO29246.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8387891..8388132 1224..1467 98   Plus
2L 8387659..8387831 1051..1223 99 -> Plus
2L 8386484..8387378 156..1050 99 -> Plus
2L 8386247..8386385 17..155 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:35:33 Download gff for BO29246.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 8387891..8388132 1224..1467 98   Plus
arm_2L 8387659..8387831 1051..1223 99 -> Plus
arm_2L 8386484..8387378 156..1050 99 -> Plus
arm_2L 8386247..8386385 17..155 100 -> Plus

BO29246.pep Sequence

Translation from 16 to 1483

> BO29246.pep
MTERQPLLLQSDASDYEGSRGSAARPVRSSPPDNTLVNVHSEDSLAAASG
SGDDEIGSTDKSYNPTHHRDLEHPTSNFDTLVHLLKGNIGTGILAMPDAF
KNAGLYVGLFGTMIMGAICTHCMHMLVNCSHELCRRFQQPSLDFSEVAYC
SFESGPLGLRRYSMLARRIVTTFLFITQIGFCCVYFLFVALNIKDVMDHY
YKMPVQIYLLIMLGPMILLNLVRNLKYLTPVSLVAALLTVAGLAITFSYM
LVDLPDVHTVKPVATWATLPLYFGTAIYAFEGIGVVLPLENNMRTPEDFG
GTTGVLNTGMVIVACLYTAVGFFGYLKYGEHVEGSITLNLPQGDTLSQLV
RISMAVAIFLSYTLQFYVPVNIVEPFVRSHFDTTRAKDLSATVLRVVLVT
FTFLLATCIPNLGSIISLVGAVSSSALALIAPPIIEVITFYNVGYGRFNW
MLWKDVLILIFGLCGFVFGTWASLAQILNDRTHASFLDH

BO29246.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:00:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG13384-PI 483 CG13384-PI 1..483 1..483 2505 100 Plus
CG13384-PH 483 CG13384-PH 1..483 1..483 2505 100 Plus
CG13384-PF 483 CG13384-PF 1..483 1..483 2505 100 Plus
CG13384-PE 483 CG13384-PE 1..483 1..483 2505 100 Plus
CG13384-PD 483 CG13384-PD 1..483 1..483 2505 100 Plus