Clone BO29278 Report

Search the DGRC for BO29278

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:292
Well:78
Vector:pDNR-Dual
Associated Gene/Transcriptn-syb-RH
Protein status:BO29278.pep: Imported from assembly
Sequenced Size:439

Clone Sequence Records

BO29278.complete Sequence

439 bp assembled on 2011-08-26

GenBank Submission: KX795940

> BO29278.complete
GAAGTTATCAGTCGACATGGGAAAGAAAGACAAGAACAAGGAACAGGCGG
ACGCTGCACCAGCTGGCGATGCACCACCCAATGCCGGAGCCCCGGCCGGA
GAGGGCGGCGATGGCGAGATTGTGGGCGGACCACACAATCCGCAGCAGAT
CGCGGCACAGAAGCGTCTGCAGCAGACGCAGGCGCAGGTCGATGAGGTCG
TGGACATCATGCGCACGAACGTGGAGAAGGTGCTGGAGCGCGACAGCAAG
CTGTCGGAGCTGGACGACCGTGCCGATGCCTTGCAGCAGGGTGCCTCGCA
GTTTGAGCAGCAGGCGGGCAAGCTCAAGAGGAAATTCTGGCTTCAGAACT
TAAAGATGATGATCATCATGGGCGTGATTGGCCTGGTTGTCGTGGGCATT
ATTGCAAAGAAAGACGAAGAAGCAAGCTTTCTAGACCAT

BO29278.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:50:27
Subject Length Description Subject Range Query Range Score Percent Strand
nSyb-RI 408 CG17248-PI 1..405 17..421 2025 100 Plus
nSyb-RH 408 CG17248-PH 1..405 17..421 2025 100 Plus
nSyb-RG 579 CG17248-PG 1..396 17..412 1965 99.7 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:50:28
Subject Length Description Subject Range Query Range Score Percent Strand
nSyb-RI 3570 CG17248-RI 527..931 17..421 2025 100 Plus
nSyb-RH 1277 CG17248-RH 527..931 17..421 2025 100 Plus
nSyb-RG 3027 CG17248-RG 530..925 17..412 1965 99.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 00:50:25
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 1635301..1635461 355..195 805 100 Minus
3L 28110227 3L 1635532..1635684 198..46 765 100 Minus
2R 25286936 2R 10250908..10251119 378..167 295 75.9 Minus
3L 28110227 3L 1635186..1635239 407..354 270 100 Minus
Blast to na_te.dros performed on 2014-11-27 00:50:26 has no hits.

BO29278.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-26 13:54:54 Download gff for BO29278.complete
Subject Subject Range Query Range Percent Splice Strand
n-syb-RH 542..946 17..423 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:35:51 Download gff for BO29278.complete
Subject Subject Range Query Range Percent Splice Strand
n-syb-RH 527..931 17..423 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:11:09 Download gff for BO29278.complete
Subject Subject Range Query Range Percent Splice Strand
nSyb-RH 527..931 17..423 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:11:09 Download gff for BO29278.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1635937..1635965 17..45 100   Minus
3L 1635534..1635684 46..196 100 <- Minus
3L 1635301..1635459 197..355 100 <- Minus
3L 1635186..1635237 356..407 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:35:51 Download gff for BO29278.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 1635937..1635965 17..45 100   Minus
arm_3L 1635534..1635684 46..196 100 <- Minus
arm_3L 1635301..1635459 197..355 100 <- Minus
arm_3L 1635186..1635237 356..407 100 <- Minus

BO29278.pep Sequence

Translation from 16 to 439

> BO29278.pep
MGKKDKNKEQADAAPAGDAPPNAGAPAGEGGDGEIVGGPHNPQQIAAQKR
LQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQA
GKLKRKFWLQNLKMMIIMGVIGLVVVGIIAKKDEEASFLDH

BO29278.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:00:09
Subject Length Description Subject Range Query Range Score Percent Strand
nSyb-PI 135 CG17248-PI 1..135 1..135 682 100 Plus
nSyb-PH 135 CG17248-PH 1..135 1..135 682 100 Plus
nSyb-PG 192 CG17248-PG 1..132 1..132 661 99.2 Plus
nSyb-PE 192 CG17248-PE 1..132 1..132 661 99.2 Plus
nSyb-PK 125 CG17248-PK 2..121 11..130 603 100 Plus