Clone BO29295 Report

Search the DGRC for BO29295

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:292
Well:95
Vector:pDNR-Dual
Associated Gene/TranscriptTfIIA-L-RB
Protein status:BO29295.pep: Imported from assembly
Sequenced Size:1123

Clone Sequence Records

BO29295.complete Sequence

1123 bp assembled on 2011-08-26

GenBank Submission: KX799995

> BO29295.complete
GAAGTTATCAGTCGACATGGCGCTATGCCAGACATCGGTGCTGAAGGTGT
ACCATGCCGTGATCGAGGACGTCATCACAAATGTGCGGGACGCGTTCCTG
GACGAGGGCGTCGACGAACAGGTGCTGCAGGAGATGAAGCAGGTCTGGCG
CAACAAGTTGCTTGCTAGCAAGGCCGTCGAGCTGAGCCCGGACTCCGGCG
ATGGCTCCCATCCGCCACCCATCGTGGCCAACAATCCAAAGGCAGCGAAT
GCCAAGGCCAAGAAGGCCGCCGCCGCAACCGCGGTCACATCACACCAACA
TATCGGCGGCAACAGCTCCATGTCCTCGCTGGTGGGGCTTAAGTCGTCCG
CTGGAATGGCCGCCGGCAGCGGCATAAGGAACGGGCTGGTGCCCATCAAG
CAGGAAGTCAACTCACAGAATCCACCGCCACTGCATCCTACCTCGGCTGC
AAGCATGATGCAGAAACAGCAGCAGGCGGCGAGCAGTGGACAGGGTTCCA
TTCCAATTGTGGCCACGCTGGACCCCAATCGCATTATGCCTGTTAACATC
ACGCTGCCATCGCCAGCCGGCTCTGCCAGTTCGGAATCTCGAGTGCTCAC
CATACAAGTGCCTGCCTCCGCGCTGCAGGAGAATCAGTTGACCCAAATTC
TGACGGCCCACCTGATTTCATCCATCATGTCCTTGCCCACCACGTTGGCC
TCGTCTGTGCTTCAGCAGCACGTAAACGCAGCGCTAAGCAGCGCCAATCA
CCAGAAAACTCTTGCCGCCGCCAAGCAATTGGACGGTGCCCTGGACTCCT
CCGATGAGGATGAAAGCGAGGAGAGCGACGACAACATCGACAACGATGAC
GACGATGACCTAGACAAGGACGATGACGAGGATGCGGAGCACGAGGATGC
TGCCGAGGAGGAGCCGCTCAACAGCGAAGACGATGTCACCGACGAAGACT
CTGCCGAAATGTTTGACACAGATAACGTGATTGTTTGTCAGTACGATAAG
ATCACCAGGTCGCGAAACAAATGGAAATTCTATCTCAAAGATGGCATCAT
GAACATGCGGGGCAAGGACTACGTGTTCCAGAAATCGAATGGCGACGCCG
AGTGGGCAAGCTTTCTAGACCAT

BO29295.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:51:02
Subject Length Description Subject Range Query Range Score Percent Strand
TfIIA-L-RB 1092 CG5930-PB 1..1089 17..1105 5445 100 Plus
TfIIA-L-RA 1101 CG5930-PA 1..1098 17..1105 5320 99.2 Plus
TfIIA-L-RC 975 CG5930-PC 1..972 134..1105 4860 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:51:03
Subject Length Description Subject Range Query Range Score Percent Strand
TfIIA-L-RB 1586 CG5930-RB 173..1261 17..1105 5445 100 Plus
TfIIA-L-RC 1440 CG5930-RC 50..1115 40..1105 5330 100 Plus
TfIIA-L-RA 1595 CG5930-RA 173..1270 17..1105 5320 99.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 00:51:00
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 27255088..27255395 240..547 1540 100 Plus
3R 32079331 3R 27255726..27255970 756..1000 1225 100 Plus
3R 32079331 3R 27255456..27255663 548..755 1040 100 Plus
3R 32079331 3R 27254527..27254729 40..242 1015 100 Plus
3R 32079331 3R 27256032..27256138 999..1105 535 100 Plus
Blast to na_te.dros performed 2014-11-27 00:51:01
Subject Length Description Subject Range Query Range Score Percent Strand
Idefix 7411 Idefix DME9736 7411bp Derived from AJ009736 (e1371475) (Rel. 58, Last updated, Version 1). 5723..5805 792..877 116 62.8 Plus

BO29295.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-26 13:54:54 Download gff for BO29295.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIA-L-RB 173..1261 17..1107 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:36:10 Download gff for BO29295.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIA-L-RB 173..1261 17..1107 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:11:30 Download gff for BO29295.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIA-L-RB 173..1261 17..1107 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:11:30 Download gff for BO29295.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27256034..27256138 1001..1107 98   Plus
3R 27255726..27255970 756..1000 100 -> Plus
3R 27255456..27255663 548..755 100 -> Plus
3R 27255090..27255395 242..547 100 -> Plus
3R 27254528..27254728 41..241 100 -> Plus
3R 27253602..27253625 17..40 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:36:10 Download gff for BO29295.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 23081756..23081860 1001..1107 98   Plus
arm_3R 23081448..23081692 756..1000 100 -> Plus
arm_3R 23081178..23081385 548..755 100 -> Plus
arm_3R 23080812..23081117 242..547 100 -> Plus
arm_3R 23080250..23080450 41..241 100 -> Plus
arm_3R 23079324..23079347 17..40 100 -> Plus

BO29295.pep Sequence

Translation from 16 to 1123

> BO29295.pep
MALCQTSVLKVYHAVIEDVITNVRDAFLDEGVDEQVLQEMKQVWRNKLLA
SKAVELSPDSGDGSHPPPIVANNPKAANAKAKKAAAATAVTSHQHIGGNS
SMSSLVGLKSSAGMAAGSGIRNGLVPIKQEVNSQNPPPLHPTSAASMMQK
QQQAASSGQGSIPIVATLDPNRIMPVNITLPSPAGSASSESRVLTIQVPA
SALQENQLTQILTAHLISSIMSLPTTLASSVLQQHVNAALSSANHQKTLA
AAKQLDGALDSSDEDESEESDDNIDNDDDDDLDKDDDEDAEHEDAAEEEP
LNSEDDVTDEDSAEMFDTDNVIVCQYDKITRSRNKWKFYLKDGIMNMRGK
DYVFQKSNGDAEWASFLDH

BO29295.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:00:13
Subject Length Description Subject Range Query Range Score Percent Strand
TfIIA-L-PB 363 CG5930-PB 1..363 1..363 1838 100 Plus
TfIIA-L-PA 366 CG5930-PA 1..366 1..363 1824 99.2 Plus
TfIIA-L-PC 324 CG5930-PC 1..324 40..363 1644 100 Plus