Clone BO29296 Report

Search the DGRC for BO29296

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:292
Well:96
Vector:pDNR-Dual
Associated Gene/TranscriptCG15347-RB
Protein status:BO29296.pep: Imported from assembly
Sequenced Size:721

Clone Sequence Records

BO29296.complete Sequence

721 bp assembled on 2011-08-26

GenBank Submission: KX799216

> BO29296.complete
GAAGTTATCAGTCGACATGAAGTTTTACCTGTTGGTGATTGCAGCCCTCT
CGTTTTTGGCCTACATCAGTTGTGGCATGACTCAATCGAAACGCTCCGTT
CCACTCGCTCAATTTGCAGATGGATGCATCCAGTGCAATTCGAAGGACAA
CGAACGCTGCGCCACAGATCCATTGAGCCTGCTCAATCGCAACTGTTCCG
ATGGATCCTCCAACTGCTATTCCCGCGTCCTGGATGGCTACACAATTCGC
GGCTGTGCCGTCGATCTGGACAACGCCACGCGTAATTCGTGCAACAACGA
GCTACTGTGCCAGCTGTGCACCTACAGCGAGGGATGCAATCGAAACACCT
TCCCGTTGAGCCGCCTCATGTGCCTACAGTGCACAGGGAACTCGACCTCG
TCGTCCTGCGCCACAGAGACCTATGTATCGGCCAAGATCTGCCCGCTGTA
CAAGTTCGGCGACAAGTGCTACATTCGCAATAGCAATCGCACCGTGGACG
GATCCTTCCAGCGCGGCTGTCTCACCTCGGCGAATGCCAGGAAGCAGTGC
GTCAAGGATGGCAACTGTTATACGTGCGAGGGACGCGGCTGCAACTTTCT
GCTGGCCAATGATACCAACATTCCGCTGGCACGCGACAGCGGTGCCCAGT
TGATCATCTCCATGACGCTGCTGATCAGCGGTCTTGTCGCCGCCTGGAGA
CTCGCAAGCTTTCTAGACCAT

BO29296.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:51:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG15347-RB 690 CG15347-PB 1..687 17..703 3435 100 Plus
CG15347-RA 645 CG15347-PA 58..642 119..703 2925 100 Plus
CG15347-RA 645 CG15347-PA 1..58 17..74 290 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:51:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG15347-RB 968 CG15347-RB 75..762 16..703 3440 100 Plus
CG15347-RA 923 CG15347-RA 133..717 119..703 2925 100 Plus
CG15347-RA 923 CG15347-RA 75..133 16..74 295 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 00:51:22
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 8458700..8459170 703..233 2355 100 Minus
X 23542271 X 8459224..8459383 233..74 800 100 Minus
X 23542271 X 8460765..8460824 75..16 300 100 Minus
Blast to na_te.dros performed on 2014-11-27 00:51:23 has no hits.

BO29296.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-26 13:54:55 Download gff for BO29296.complete
Subject Subject Range Query Range Percent Splice Strand
CG15347-RB 72..758 17..705 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:36:22 Download gff for BO29296.complete
Subject Subject Range Query Range Percent Splice Strand
CG15347-RB 76..762 17..705 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:11:38 Download gff for BO29296.complete
Subject Subject Range Query Range Percent Splice Strand
CG15347-RB 76..762 17..705 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:11:38 Download gff for BO29296.complete
Subject Subject Range Query Range Percent Splice Strand
X 8460766..8460823 17..74 100   Minus
X 8459224..8459382 75..233 100 <- Minus
X 8458698..8459169 234..705 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:36:22 Download gff for BO29296.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 8354799..8354856 17..74 100   Minus
arm_X 8353257..8353415 75..233 100 <- Minus
arm_X 8352731..8353202 234..705 99 <- Minus

BO29296.pep Sequence

Translation from 16 to 721

> BO29296.pep
MKFYLLVIAALSFLAYISCGMTQSKRSVPLAQFADGCIQCNSKDNERCAT
DPLSLLNRNCSDGSSNCYSRVLDGYTIRGCAVDLDNATRNSCNNELLCQL
CTYSEGCNRNTFPLSRLMCLQCTGNSTSSSCATETYVSAKICPLYKFGDK
CYIRNSNRTVDGSFQRGCLTSANARKQCVKDGNCYTCEGRGCNFLLANDT
NIPLARDSGAQLIISMTLLISGLVAAWRLASFLDH

BO29296.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:00:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG15347-PB 229 CG15347-PB 1..229 1..229 1231 100 Plus
CG15347-PA 214 CG15347-PA 1..214 1..229 1132 93.4 Plus
CG13492-PD 2979 CG13492-PD 2799..2975 37..226 204 26.9 Plus
CG13492-PD 2979 CG13492-PD 1538..1695 37..193 184 31.7 Plus
CG13492-PD 2979 CG13492-PD 2372..2540 27..198 180 31.5 Plus
CG13492-PD 2979 CG13492-PD 1956..2114 27..193 177 33.1 Plus
CG13492-PD 2979 CG13492-PD 698..849 37..193 176 31.1 Plus
CG13492-PD 2979 CG13492-PD 278..432 37..193 169 33.9 Plus
CG13492-PD 2979 CG13492-PD 2638..2790 37..195 162 29.9 Plus
CG15773-PB 319 CG15773-PB 33..177 37..193 160 29.4 Plus
CG4363-PA 199 CG4363-PA 24..180 34..193 155 25.5 Plus
CG13492-PD 2979 CG13492-PD 1120..1271 37..193 154 26.9 Plus