Clone BO30109 Report

Search the DGRC for BO30109

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:301
Well:9
Vector:pDNR-Dual
Associated Gene/Transcriptstck-RB
Protein status:BO30109.pep: Imported from assembly
Sequenced Size:1069

Clone Sequence Records

BO30109.complete Sequence

1069 bp assembled on 2011-09-12

GenBank Submission: KX799682

> BO30109.complete
GAAGTTATCAGTCGACATGCCGCCCGTGCAAGTCCAGGCAGCGAACATGT
CGCTGGGTGCCATGCATTGTACGCGATGTGCCGACGGCTTCGAGCCGACT
GAGAAGATTGTTAACTCCAATGGAGAACTCTGGCACACCCAGTGCTTCGT
ATGTGCCCAGTGCTTCCGACCCTTCCAGGATGGGATATTCTACGAGTTCG
AGGGCCGTAAGTACTGTGAACGCGACTTTCACGTGCTCTTCGCTCCCTGC
TGCAACAAGTGCGGCGAGTTCGTCATCGGACGGGTCATCAAGGCCATGTC
AGCTAGCTGGCATCCACAGTGCTTCCGCTGCCAATTGTGCGCCAAGGAGC
TGGCTGATTGCGGATTCATCAAGAACCAGAACCGCGCCTTGTGTCACGAG
TGCAATGCCAAGGTGAAGGCGGAGATTACCGGCCGCTATGTATGCCAAAA
ATGCCACGGCCTCATCGACGAGGAGCCTTTGCGATTCCGGGGCGAAGTGT
ACCACGGCTATCACTTCAGTTGCACGGCCTGCGGCACAGAGTTGGATTCC
ACTGCTCGGGAGGTCAAGAGCCGGCCAGGATTGGCTGCTAACGATATGAA
CGAACTGTATTGTCTGCGTTGTCACGATAAAATGGGCATTCCCATATGTG
GTGCCTGTCGTCGTCCGATTGAGGAGAGGGTGGTAACGGCGCTCGGAAAG
CACTGGCATGTGGAACATTTCGTGTGCGCCAAGTGCGAGAAACCCTTCTT
GGGTCACCGACACTACGAGAAGCGGGGATTGGCCTACTGCGAGACGCACT
ATCATCAGCTCTTTGGCAACCTGTGCTTCGTCTGCAACCAGGTTATTGGA
GGCGATGTTTTCACTGCCTTGAACAAGGCCTGGTGTGTGCACCACTTTGC
GTGCTCCGTGTGCGACACGAAGATGACACAAAAATCGAAATTCTACGAGT
ACGACGAGAAGCCGGTGTGCAAAAAGTGCTATGACCGATTTCCAAACGAA
CTCAGACGACGTCTGCGCACCGCCCACGAGATGACAATGAAAAAGAACAC
CGCAAGCTTTCTAGACCAT

BO30109.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:08:11
Subject Length Description Subject Range Query Range Score Percent Strand
stck-RB 1038 CG7954-PB 1..1035 17..1051 5175 100 Plus
stck-RC 1047 CG7954-PC 24..1044 31..1051 5105 100 Plus
stck-RD 1008 CG7954-PD 1..1005 47..1051 5025 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:08:12
Subject Length Description Subject Range Query Range Score Percent Strand
stck-RD 1500 CG7954-RD 225..1259 17..1051 5175 100 Plus
stck-RB 1388 CG7954-RB 113..1147 17..1051 5175 100 Plus
stck-RC 1335 CG7954-RC 78..1098 31..1051 5105 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:08:09
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 8358649..8358954 151..456 1530 100 Plus
3R 32079331 3R 8359206..8359465 598..857 1300 100 Plus
3R 32079331 3R 8359529..8359723 857..1051 975 100 Plus
3R 32079331 3R 8359009..8359150 457..598 710 100 Plus
3R 32079331 3R 8358471..8358590 31..150 600 100 Plus
Blast to na_te.dros performed on 2014-11-27 07:08:10 has no hits.

BO30109.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-12 16:33:52 Download gff for BO30109.complete
Subject Subject Range Query Range Percent Splice Strand
stck-RB 109..1143 17..1053 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:06:22 Download gff for BO30109.complete
Subject Subject Range Query Range Percent Splice Strand
stck-RB 113..1147 17..1053 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:03:53 Download gff for BO30109.complete
Subject Subject Range Query Range Percent Splice Strand
stck-RB 113..1147 17..1053 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:03:53 Download gff for BO30109.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8359530..8359723 858..1053 98   Plus
3R 8359207..8359465 599..857 100 -> Plus
3R 8359009..8359150 457..598 100 -> Plus
3R 8358649..8358954 151..456 100 -> Plus
3R 8358471..8358590 31..150 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:06:22 Download gff for BO30109.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 4185252..4185445 858..1053 98   Plus
arm_3R 4184929..4185187 599..857 100 -> Plus
arm_3R 4184731..4184872 457..598 100 -> Plus
arm_3R 4184371..4184676 151..456 100 -> Plus
arm_3R 4184193..4184312 31..150 100 -> Plus

BO30109.pep Sequence

Translation from 16 to 1069

> BO30109.pep
MPPVQVQAANMSLGAMHCTRCADGFEPTEKIVNSNGELWHTQCFVCAQCF
RPFQDGIFYEFEGRKYCERDFHVLFAPCCNKCGEFVIGRVIKAMSASWHP
QCFRCQLCAKELADCGFIKNQNRALCHECNAKVKAEITGRYVCQKCHGLI
DEEPLRFRGEVYHGYHFSCTACGTELDSTAREVKSRPGLAANDMNELYCL
RCHDKMGIPICGACRRPIEERVVTALGKHWHVEHFVCAKCEKPFLGHRHY
EKRGLAYCETHYHQLFGNLCFVCNQVIGGDVFTALNKAWCVHHFACSVCD
TKMTQKSKFYEYDEKPVCKKCYDRFPNELRRRLRTAHEMTMKKNTASFLD
H

BO30109.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:14:40
Subject Length Description Subject Range Query Range Score Percent Strand
stck-PB 345 CG7954-PB 1..345 1..345 1971 100 Plus
stck-PC 348 CG7954-PC 9..348 6..345 1943 100 Plus
stck-PD 335 CG7954-PD 1..335 11..345 1920 100 Plus
stck-PA 335 CG7954-PA 1..335 11..345 1920 100 Plus
Pax-PB 556 CG31794-PB 322..553 78..324 400 32.7 Plus