Clone BO30110 Report

Search the DGRC for BO30110

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:301
Well:10
Vector:pDNR-Dual
Associated Gene/Transcriptnrv3-RA
Protein status:BO30110.pep: Imported from assembly
Sequenced Size:967

Clone Sequence Records

BO30110.complete Sequence

967 bp assembled on 2011-09-12

GenBank Submission: KX797984

> BO30110.complete
GAAGTTATCAGTCGACATGGCCGATAAAAAAATTGGTGAATACTATGCAC
CACCTGTGAAAATGGGCAAATGGGAGGGTTTCAAAAAATTCCTATGGAAC
AGTGAAACTAGCCAATGCCTTGGACGCACCGGATCCAGTTGGGCGAAAAT
TCTCCTATTTTACATAATTTTTTATGCGGCGTTAACTGGTTTTTTTGCTG
CAATTTTCACTGTATTTTATCAAACTTTGGACAATGAAAAGCCAAAATGG
ATGCTTGACAATGGTTTGATAGGGTCCAACCCAGGTCTAGGCTTTCGACC
AATGCCACCGGAAGCGAATGTTGAGAGCACATTAGTTTGGTACGAGTCAT
CAAAGAAGGATAACTATAAGTACTGGGTGGACGAGACTTCACGTTTTCTG
AAATCGTACCAAGATCTTGAGAAGCAAAATCAAGTGAACTGTAGCTTTGA
ACATCCACCACAAGACGACAAGGTCTGCGGCATTGACTTCTCCAGCTTCT
CGCCATGTACAGCTGACAACAACTTTGGCTACCACGTTGCCCGGCCATGT
ATATTCCTTAAGTTGAATAAGATTTACAATTGGATACCAGAAATTTACAA
CGATTCTAAGACTTTGCCAGATCATATGCCAGAGGAACTAAAACAGCACA
TCAAGGAAAAGCAAAGTCTTAGGCCCAATGAAACAAATGTAGTTTGGGTC
TCGTGCGAGGGAGAAAATCCCGCTGATGTAGAGAACATAAAAGCACGCGA
CTACTATCCCCGAATGGGATTTCCTCGTTACTATTTTCCGTTTAAAAACA
TTCAGGGATATATACCGCCCATTGTTGCTGTTCAATTTACCGTTGAAACC
GGCGTTTTGATCAACATTGAATGTAAAGCTTGGGCCCGCAACATTAATCA
CGACCGTTCAGACAGAAGAGGATCCGTTCACTTCGAGTTGATGGTTGATG
CAAGCTTTCTAGACCAT

BO30110.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:12:56
Subject Length Description Subject Range Query Range Score Percent Strand
nrv3-RD 936 CG8663-PD 1..933 17..949 4650 99.9 Plus
nrv3-RC 936 CG8663-PC 1..933 17..949 4650 99.9 Plus
nrv3-RA 936 CG8663-PA 1..933 17..949 4650 99.9 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:12:57
Subject Length Description Subject Range Query Range Score Percent Strand
nrv3-RD 4514 CG8663-RD 415..1347 17..949 4650 99.9 Plus
nrv3-RC 1675 CG8663-RC 548..1480 17..949 4650 99.9 Plus
nrv3-RA 1519 CG8663-RA 392..1324 17..949 4650 99.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:12:54
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 21388503..21388669 405..571 835 100 Plus
2L 23513712 2L 21388914..21389079 683..848 815 99.4 Plus
2L 23513712 2L 21384454..21384597 143..286 720 100 Plus
2L 23513712 2L 21382204..21382330 17..143 635 100 Plus
2L 23513712 2L 21385275..21385397 282..404 615 100 Plus
2L 23513712 2L 21388730..21388842 570..682 565 100 Plus
2L 23513712 2L 21390052..21390152 849..949 505 100 Plus
Blast to na_te.dros performed on 2014-11-27 07:12:55 has no hits.

BO30110.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-12 10:52:41 Download gff for BO30110.complete
Subject Subject Range Query Range Percent Splice Strand
nrv3-RD 741..1673 17..951 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:08:55 Download gff for BO30110.complete
Subject Subject Range Query Range Percent Splice Strand
nrv3-RC 548..1480 17..951 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:05:55 Download gff for BO30110.complete
Subject Subject Range Query Range Percent Splice Strand
nrv3-RA 392..1324 17..951 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:05:55 Download gff for BO30110.complete
Subject Subject Range Query Range Percent Splice Strand
2L 21390052..21390152 849..951 98   Plus
2L 21388914..21389079 683..848 99 -> Plus
2L 21388732..21388842 572..682 100 -> Plus
2L 21388503..21388669 405..571 100 -> Plus
2L 21385278..21385397 285..404 100 -> Plus
2L 21384455..21384595 144..284 100 -> Plus
2L 21382204..21382330 17..143 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:08:55 Download gff for BO30110.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 21390052..21390152 849..951 98   Plus
arm_2L 21388914..21389079 683..848 99 -> Plus
arm_2L 21388732..21388842 572..682 100 -> Plus
arm_2L 21388503..21388669 405..571 100 -> Plus
arm_2L 21385278..21385397 285..404 100 -> Plus
arm_2L 21384455..21384595 144..284 100 -> Plus
arm_2L 21382204..21382330 17..143 100 -> Plus

BO30110.pep Sequence

Translation from 16 to 967

> BO30110.pep
MADKKIGEYYAPPVKMGKWEGFKKFLWNSETSQCLGRTGSSWAKILLFYI
IFYAALTGFFAAIFTVFYQTLDNEKPKWMLDNGLIGSNPGLGFRPMPPEA
NVESTLVWYESSKKDNYKYWVDETSRFLKSYQDLEKQNQVNCSFEHPPQD
DKVCGIDFSSFSPCTADNNFGYHVARPCIFLKLNKIYNWIPEIYNDSKTL
PDHMPEELKQHIKEKQSLRPNETNVVWVSCEGENPADVENIKARDYYPRM
GFPRYYFPFKNIQGYIPPIVAVQFTVETGVLINIECKAWARNINHDRSDR
RGSVHFELMVDASFLDH

BO30110.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:09:34
Subject Length Description Subject Range Query Range Score Percent Strand
nrv3-PD 311 CG8663-PD 1..311 1..311 1716 100 Plus
nrv3-PC 311 CG8663-PC 1..311 1..311 1716 100 Plus
nrv3-PA 311 CG8663-PA 1..311 1..311 1716 100 Plus
nrv3-PE 313 CG8663-PE 1..313 1..311 1700 99 Plus
nrv2-PG 323 CG9261-PG 14..323 8..311 884 50.3 Plus