Clone BO30113 Report

Search the DGRC for BO30113

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:301
Well:13
Vector:pDNR-Dual
Associated Gene/TranscriptTm2-RA
Protein status:BO30113.pep: Imported from assembly
Sequenced Size:886

Clone Sequence Records

BO30113.complete Sequence

886 bp assembled on 2011-09-12

GenBank Submission: KX796923

> BO30113.complete
GAAGTTATCAGTCGACATGGACGCCATCAAGAAGAAGATGCAAGCGATGA
AGCTTGAGAAGGATAACGCCATTGACAAGGCCGACACCTGCGAGAACCAA
GCCAAGGATGCCAACTCCCGCGCCGACAAACTGAACGAGGAGGTGCGCGA
TCTGGAGAAGAAGTTCGTCCAGGTGGAGATCGATCTGGTTACCGCCAAGG
AGCAGCTGGAGAAGGCCAACACCGAGCTGGAGGAGAAGGAGAAACTCCTG
ACCGCCACCGAGTCCGAGGTGGCCACCCAGAACCGCAAGGTGCAACAGAT
TGAGGAGGATCTGGAGAAGTCCGAGGAGCGCTCGACCACCGCCCAACAGA
AGCTGCTGGAGGCCACCCAGTCGGCCGATGAGAACAACCGCATGTGCAAG
GTGCTGGAGAACCGTTCCCAGCAGGATGAGGAGCGCATGGACCAGCTGAC
CAACCAGTTGAAGGAGGCCCGCATGCTGGCTGAGGATGCCGATACCAAGT
CCGACGAGGTCTCCCGCAAGCTGGCCTTCGTTGAAGACGAGCTGGAGGTG
GCTGAGGATCGTGTCCGCTCCGGCGAGTCCAAGATCATGGAGCTGGAGGA
GGAGCTGAAGGTTGTCGGCAACTCCCTGAAGTCCCTGGAGGTGTCCGAGG
AGAAGGCCAACCAGCGCGTGGAGGAGTTCAAGCGCGAGATGAAGACCCTG
TCCATCAAGTTGAAGGAGGCCGAGCAGCGCGCCGAGCACGCCGAGAAGCA
AGTGAAGCGCCTGCAGAAGGAGGTCGACAGGCTAGAGGACGAGTTGGGCA
TCAACAAGGACAGGTACAAGTCCCTGGCCGACGAGATGGACTCCACATTC
GCCGAATTGGCTGGCTACGCAAGCTTTCTAGACCAT

BO30113.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:13:23
Subject Length Description Subject Range Query Range Score Percent Strand
Tm2-RG 855 CG4843-PG 1..852 17..868 4260 100 Plus
Tm2-RF 855 CG4843-PF 1..852 17..868 4260 100 Plus
Tm2-RE 855 CG4843-PE 1..852 17..868 4260 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:13:24
Subject Length Description Subject Range Query Range Score Percent Strand
Tm2-RG 1145 CG4843-RG 77..929 16..868 4265 100 Plus
Tm2-RF 1200 CG4843-RF 132..984 16..868 4265 100 Plus
Tm2-RE 1892 CG4843-RE 450..1302 16..868 4265 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:13:21
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 15312452..15313048 16..612 2985 100 Plus
3R 32079331 3R 15313107..15313286 609..788 900 100 Plus
3R 32079331 3R 15314527..15314607 788..868 405 100 Plus
Blast to na_te.dros performed on 2014-11-27 07:13:22 has no hits.

BO30113.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-12 10:52:42 Download gff for BO30113.complete
Subject Subject Range Query Range Percent Splice Strand
Tm2-RB 158..1009 17..870 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:09:11 Download gff for BO30113.complete
Subject Subject Range Query Range Percent Splice Strand
Tm2-RB 214..1065 17..870 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:06:04 Download gff for BO30113.complete
Subject Subject Range Query Range Percent Splice Strand
Tm2-RE 451..1302 17..870 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:06:04 Download gff for BO30113.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15314528..15314607 789..870 97   Plus
3R 15313109..15313286 611..788 100 -> Plus
3R 15312453..15313046 17..610 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:09:11 Download gff for BO30113.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 11140250..11140329 789..870 97   Plus
arm_3R 11138831..11139008 611..788 100 -> Plus
arm_3R 11138175..11138768 17..610 100 -> Plus

BO30113.pep Sequence

Translation from 16 to 886

> BO30113.pep
MDAIKKKMQAMKLEKDNAIDKADTCENQAKDANSRADKLNEEVRDLEKKF
VQVEIDLVTAKEQLEKANTELEEKEKLLTATESEVATQNRKVQQIEEDLE
KSEERSTTAQQKLLEATQSADENNRMCKVLENRSQQDEERMDQLTNQLKE
ARMLAEDADTKSDEVSRKLAFVEDELEVAEDRVRSGESKIMELEEELKVV
GNSLKSLEVSEEKANQRVEEFKREMKTLSIKLKEAEQRAEHAEKQVKRLQ
KEVDRLEDELGINKDRYKSLADEMDSTFAELAGYASFLDH

BO30113.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:09:36
Subject Length Description Subject Range Query Range Score Percent Strand
Tm2-PG 284 CG4843-PG 1..284 1..284 1384 100 Plus
Tm2-PF 284 CG4843-PF 1..284 1..284 1384 100 Plus
Tm2-PE 284 CG4843-PE 1..284 1..284 1384 100 Plus
Tm2-PB 284 CG4843-PB 1..284 1..284 1384 100 Plus
Tm2-PA 284 CG4843-PA 1..284 1..284 1384 100 Plus