Clone BO30132 Report

Search the DGRC for BO30132

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:301
Well:32
Vector:pDNR-Dual
Associated Gene/Transcriptbeat-Ib-RA
Protein status:BO30132.pep: Imported from assembly
Sequenced Size:1015

Clone Sequence Records

BO30132.complete Sequence

1015 bp assembled on 2011-09-12

GenBank Submission: KX794331

> BO30132.complete
GAAGTTATCAGTCGACATGCAAAAGCCAGCGCTTAAACTGCGTCGACTCT
TCATCATTACCGCAATTTATATAGCCAGTTTGCCAGGTCTCACTGTTGGG
CTGCGGAACGTCAACGTTCGCATACCGTCCGCCGTTAAGCGTGGCGATAA
TGCGCTCTTAATCTGCAATTATGACATCGAGAACGACACGCTCTACACGG
TGAAATGGTATCGTGGCAGACGGGAGTTCTACCGCTATACGCCCAAGGAA
AATCCGGCCTGGAAGATATTCACCAAAACGAACGAAATCGATGTCGAGAC
TGCCCAATCGAATGCCAGCCACGTTCTTTTGCGAAATGTTCCCACCTCAA
TATCGGGCAAATTTGCCTGCGAAGTGTCCGCAGATGCACCCACCTTCGAT
ACTTCCATCGTGGCCGCCGACATGGAGGTGGTTGAATTGCCCACCCAACG
ACCCATAATTACTGGCATCCATTCAAGATACCGTCTGGGGGACGTTATAA
ATGGGAACTGCTCATCGGATTACTCCAAGCCGGCTGCGAATCTCACCTGG
TGGATCAATGACATACAGGTGCCACCCAATTATCTCCGCATCTACGACAT
TCAGCGGCACGTGGCCGAGCATCTGGAGTCGGCGGTTTTGGAGATCAAAT
TCGTGGTGACGGTACATCACTTCATCAAGAGTCGCTTAAAGTTGAAATGT
TCGGCAAGGATACACGAAATTTACGCACAGGAGAGCGAAAAATTAATCGA
GGAAGATCGTCCCAGGATTCTGGCCTCTGGCAGATCACCTGATATGAATA
TGTATCCATTTGATCAGCCAGGGGATGCAGATGAGCATAACGAACTATTT
TTGATCCATTCAAATGCGGCTTGCGGACCATTTGCCTGGCATCCGATTTT
GTTTTTGCTGTTGTGGCCAAGTTTCTGGGTTTTCGCCGCCTGGGAGAACT
GGCTGTGGAACCTGTTGGAGGCTCGACTTTTTGGCAGGGCGGTGCGGGCA
AGCTTTCTAGACCAT

BO30132.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:16:33
Subject Length Description Subject Range Query Range Score Percent Strand
beat-Ib-RB 984 CG7644-PB 1..981 17..997 4905 100 Plus
beat-Ib-RA 984 CG7644-PA 1..981 17..997 4905 100 Plus
beat-Ic-RC 1605 CG4838-PC 217..326 149..258 190 78.2 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:16:34
Subject Length Description Subject Range Query Range Score Percent Strand
beat-Ib-RB 2611 CG7644-RB 1085..2065 17..997 4905 100 Plus
beat-Ib-RA 2603 CG7644-RA 1077..2057 17..997 4905 100 Plus
beat-Ic-RC 4695 CG4838-RC 1134..1243 149..258 190 78.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:16:31
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 15906549..15906806 691..434 1290 100 Minus
2L 23513712 2L 15908067..15908286 298..79 1085 99.5 Minus
2L 23513712 2L 15906318..15906491 863..690 870 100 Minus
2L 23513712 2L 15906864..15907001 434..297 690 100 Minus
2L 23513712 2L 15905680..15905818 997..859 680 99.3 Minus
2L 23513712 2L 15939362..15939433 88..17 360 100 Minus
2L 23513712 2L 16032442..16032551 149..258 190 78.2 Plus
Blast to na_te.dros performed on 2014-11-27 07:16:32 has no hits.

BO30132.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-12 10:52:44 Download gff for BO30132.complete
Subject Subject Range Query Range Percent Splice Strand
beat-Ib-RB 1082..2062 17..999 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:10:41 Download gff for BO30132.complete
Subject Subject Range Query Range Percent Splice Strand
beat-Ib-RA 1077..2057 17..999 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:07:12 Download gff for BO30132.complete
Subject Subject Range Query Range Percent Splice Strand
beat-Ib-RA 1077..2057 17..999 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:07:12 Download gff for BO30132.complete
Subject Subject Range Query Range Percent Splice Strand
2L 15939364..15939433 17..86 100   Minus
2L 15908067..15908278 87..298 100 <- Minus
2L 15906864..15906999 299..434 100 <- Minus
2L 15906549..15906805 435..691 100 <- Minus
2L 15906318..15906489 692..863 100 <- Minus
2L 15905677..15905813 864..999 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:10:41 Download gff for BO30132.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 15939364..15939433 17..86 100   Minus
arm_2L 15908067..15908278 87..298 100 <- Minus
arm_2L 15906864..15906999 299..434 100 <- Minus
arm_2L 15906549..15906805 435..691 100 <- Minus
arm_2L 15906318..15906489 692..863 100 <- Minus
arm_2L 15905677..15905813 864..999 98 <- Minus

BO30132.pep Sequence

Translation from 16 to 1015

> BO30132.pep
MQKPALKLRRLFIITAIYIASLPGLTVGLRNVNVRIPSAVKRGDNALLIC
NYDIENDTLYTVKWYRGRREFYRYTPKENPAWKIFTKTNEIDVETAQSNA
SHVLLRNVPTSISGKFACEVSADAPTFDTSIVAADMEVVELPTQRPIITG
IHSRYRLGDVINGNCSSDYSKPAANLTWWINDIQVPPNYLRIYDIQRHVA
EHLESAVLEIKFVVTVHHFIKSRLKLKCSARIHEIYAQESEKLIEEDRPR
ILASGRSPDMNMYPFDQPGDADEHNELFLIHSNAACGPFAWHPILFLLLW
PSFWVFAAWENWLWNLLEARLFGRAVRASFLDH

BO30132.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:09:46
Subject Length Description Subject Range Query Range Score Percent Strand
beat-Ib-PB 327 CG7644-PB 1..327 1..327 1741 100 Plus
beat-Ib-PA 327 CG7644-PA 1..327 1..327 1741 100 Plus
beat-Ic-PC 534 CG4838-PC 40..338 12..302 820 51.2 Plus
beat-Ic-PB 534 CG4838-PB 40..338 12..302 820 51.2 Plus
beat-Ic-PA 534 CG4838-PA 40..338 12..302 820 51.2 Plus