Clone BO30134 Report

Search the DGRC for BO30134

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:301
Well:34
Vector:pDNR-Dual
Associated Gene/TranscriptCG33281-RA
Protein status:BO30134.pep: Imported from assembly
Sequenced Size:1435

Clone Sequence Records

BO30134.complete Sequence

1435 bp assembled on 2011-09-12

GenBank Submission: KX793851

> BO30134.complete
GAAGTTATCAGTCGACATGAGTTCCACCGGCGGTGACAAATACCAATATC
TAGCTGCAATCAGTGTAAACATCATTTCGATTTCGTATGGCGCTTTTTGC
GGATGGCCATCGTCCAGTTTCCTGGAATTGTCATCAGAAAATAGTCCTTT
GGATACGGGTCCTTTGACGCCAACGGATCAGGGATGGGTGGCGTCGAATA
TATGCCTGGGAGGCCTGGTGGGCACCTTTCTGTTTACCTGGCTGGCGGAC
AGAATCGGCAGGAAATTGTGTCTCATGTGGATGGCGCTGCCCAATTTGCT
AGGCTGGGTGATAATACCGTTCGCGCGCACTCCCATGCATTTAATTATCG
CTAGATTTATTGGTGGAGCCGCTGGCGGTGGATGTTTCACAGTGATTCCC
ATTTATATAGCCGAGTTAGCCTCGGACAATATTCGCGGCATTTTGGGCGT
CTTTTTGGTGCTGACCTGCAATTTCGGTCTCGTGCTGGCCTTCGTCCTTG
GCTACTACTTCAACTATGCCCAAGTGTCCTGGATTGTGTCCTCGCTGTCC
TTTGTGTTCGTCGGCTGTTTCTGGTTCATGCCGGAAACACCGCAGCACCT
GGCCAAGATAAACAAGATTGAGGAGGCGGAGCATTCGCTGCGCTACTACC
GGAACATCAAGTCTAATCCGGCCAAGGAACTCAGCGAGGAGCTGCAACTG
GAGCTTCAGAAGTTAAAGACCACCGAGAAGACCACTGCGGATGGAGTTGA
TGACGATGACGCGGCCACCGGCGTAACTTGGTCCGACTTCGCTGAGGGCA
AGACTCGAAAGGCATTCCTAATCGGACTCGGACTGATAAGCTTCAATCAG
CTGTGCGGATGCTTCGCCATGCTGAACTATACGGCCGTAATTTTCGAGCA
AGCTGGCTCCAGCCTTCCGCCCACAGTGGCCGCCATCATAGTGGGTGTCA
TCCAACTAATGGGCACCTATGCATCCACCGTTTTGGTGGAGCGACTGGGC
CGTAAGATCCTGCTCCTGGTCTCTGCGGTGGGAATCGGATTGGGCCAGAG
TGCGATGGGCACGTATAGCTACTTCCAGATGCTCGGATGCCCAGTGGCAT
CGTTCAGCTGGGTGCCCATCGCTGGGTTCTCCTTCATGCTGTTCCTGGCT
GCAGTCGGACTGCTCTCCCTGCCATTCCTGGTGGTATCGGAAATAATGCC
GCAGAAGATAAGGAGCACGGCCATCATGATTCTAATGTCGACACTCTGGT
TAATTTCCACCTGCGCCGTAAAGTTGATGCCGGTTTTCACTGAATCCCTA
GGAATGCACGGAACCGTCTTCATGTTTGCCAGCTTATCCTTCCTAGCAGC
AATTTTCATCGCTATTTTCGTGCCCGAAACCAAGGGCAAGTCAGTTGATG
CCATCTTGGCCAGTCTCGCAAGCTTTCTAGACCAT

BO30134.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:14:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG33281-RA 1404 CG33281-PA 1..1401 17..1417 7005 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:14:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG33281-RA 1594 CG33281-RA 131..1531 17..1417 7005 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:14:35
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3325881..3326363 791..1273 2415 100 Plus
2L 23513712 2L 3325121..3325487 430..796 1820 99.7 Plus
2L 23513712 2L 3324648..3324881 65..298 1170 100 Plus
2L 23513712 2L 3326429..3326574 1272..1417 730 100 Plus
2L 23513712 2L 3324936..3325067 298..429 660 100 Plus
2L 23513712 2L 3324367..3324415 17..65 245 100 Plus
Blast to na_te.dros performed on 2014-11-27 07:14:36 has no hits.

BO30134.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-12 10:52:43 Download gff for BO30134.complete
Subject Subject Range Query Range Percent Splice Strand
CG33281-RA 134..1534 17..1419 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:09:45 Download gff for BO30134.complete
Subject Subject Range Query Range Percent Splice Strand
CG33281-RA 131..1531 17..1419 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:06:29 Download gff for BO30134.complete
Subject Subject Range Query Range Percent Splice Strand
CG33281-RA 131..1531 17..1419 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:06:29 Download gff for BO30134.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3326431..3326574 1274..1419 98   Plus
2L 3325882..3326363 792..1273 100 -> Plus
2L 3325121..3325482 430..791 100 -> Plus
2L 3324937..3325067 299..429 100 -> Plus
2L 3324649..3324881 66..298 100 -> Plus
2L 3324367..3324415 17..65 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:09:45 Download gff for BO30134.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 3326431..3326574 1274..1419 98   Plus
arm_2L 3325882..3326363 792..1273 100 -> Plus
arm_2L 3325121..3325482 430..791 100 -> Plus
arm_2L 3324937..3325067 299..429 100 -> Plus
arm_2L 3324649..3324881 66..298 100 -> Plus
arm_2L 3324367..3324415 17..65 100 -> Plus

BO30134.pep Sequence

Translation from 16 to 1435

> BO30134.pep
MSSTGGDKYQYLAAISVNIISISYGAFCGWPSSSFLELSSENSPLDTGPL
TPTDQGWVASNICLGGLVGTFLFTWLADRIGRKLCLMWMALPNLLGWVII
PFARTPMHLIIARFIGGAAGGGCFTVIPIYIAELASDNIRGILGVFLVLT
CNFGLVLAFVLGYYFNYAQVSWIVSSLSFVFVGCFWFMPETPQHLAKINK
IEEAEHSLRYYRNIKSNPAKELSEELQLELQKLKTTEKTTADGVDDDDAA
TGVTWSDFAEGKTRKAFLIGLGLISFNQLCGCFAMLNYTAVIFEQAGSSL
PPTVAAIIVGVIQLMGTYASTVLVERLGRKILLLVSAVGIGLGQSAMGTY
SYFQMLGCPVASFSWVPIAGFSFMLFLAAVGLLSLPFLVVSEIMPQKIRS
TAIMILMSTLWLISTCAVKLMPVFTESLGMHGTVFMFASLSFLAAIFIAI
FVPETKGKSVDAILASLASFLDH

BO30134.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:09:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG33281-PA 467 CG33281-PA 1..467 1..467 2395 100 Plus
CG14606-PB 438 CG14606-PB 1..434 20..458 710 34.7 Plus
CG14606-PA 438 CG14606-PA 1..434 20..458 710 34.7 Plus
CG15406-PA 469 CG15406-PA 18..467 10..460 689 33.9 Plus
CG15408-PA 466 CG15408-PA 17..463 7..460 659 31.2 Plus