Clone BO30135 Report

Search the DGRC for BO30135

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:301
Well:35
Vector:pDNR-Dual
Associated Gene/TranscriptCG6738-RA
Protein status:BO30135.pep: Imported from assembly
Sequenced Size:1237

Clone Sequence Records

BO30135.complete Sequence

1237 bp assembled on 2011-09-12

GenBank Submission: KX793964

> BO30135.complete
GAAGTTATCAGTCGACATGAGTGCCGAAAAATGGGAAAAGAACGAGGAAA
TTCGAATATTCCGGGAGTATTTGCGAATTCCATCTGTACACCCTAATATT
GATTATACTGCTTGTGTGGAGTTTATTAAGCGGCAGGCAGATTCCCTCAA
TCTGCCCGTGGAAGTAGTTTTTCCAGCTGTTAAATCAAAACCTGTGGTGA
TCATTAAATGGGAAGGAAGCCAGCCAAAGTTGCCCTCAATCATTTTAAGC
TCGCACATGGACGTGGTTCCTGTATTCCCGGAAATGTGGACCCATGAACC
CTTCTCCGCCGACATCGACGAGGAGGGTAGGATCTTTGCACGAGGTGCTC
AGGACATGAAATCGGTGGGCACTCAGTATCTAGGAGCTATACGCCTGCTG
AGGGCTGATGGCTTTCAGCCGAAAAGGACGCTCTATGTAACCTTTGTTCC
TGACGAGGAGATTGGAGGCATCCATGGCATGGCAGCGTTCGTTGAAACTG
ACTTTTACAAACAAATGAATGTGGGATTCAGCTTGGACGAGGGTGGAACT
AGTGCTTCTGATGTTCATCACTTGTTCTACGCCGAGCGTATACGATGGAT
TCTCAAATTGAAAGTTGCTGGAACCGCCGGTCATGGTTCTCTATTGTTGC
CCGATACAGCCGGAGTTAAGTTGAACTATGTGTTGAACAAGCTGACGGAG
TTCCGTGAATCGCAAATCCAGCGACTGAAAAACGACAAAAGCCTGAGCAT
CGGGGATGTGACCACGGTGAATCTCACCCAGTTGAGTGGCGGAGTGCAGA
GCAATGTGGTTCCACCGCTTTTTGAGGCCATTTTCGACATACGTCTAGCC
ATAACCCTGGATTTGGTTGCATTTGAGCGGGAAATTCGAAATTGGTGCGA
GGAGGCAGGTGGAGGCATTGACATCGAGTTCCCACTGAAAGAGGCCTATG
TGGCGGCCACCAGGCTGGATGATTCAAACCCCTATTGGTTAGCTTTGAAA
GTCGCTCTGGATGAACTGGGTCTTAAAGTTAAGCCGATAGTGTGTTTTGC
AGTCACCGATTGTCGTTTTATTCGCCAGCAGGGAACCCCAGCAATTGGTT
TCTCACCCATCATAAACACTACAGTACTAATCCATGACCATGATGAATTT
TTAAGGGCTGATGATTATTTGAATGGCATACAAGTTTACAAGAAGATTAT
TCCTAATCTCACTGAAGTCGCAAGCTTTCTAGACCAT

BO30135.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:15:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG6738-RA 1206 CG6738-PA 1..1203 17..1219 6015 100 Plus
CG6733-RA 1206 CG6733-PA 10..1203 26..1219 1680 76 Plus
CG17109-RB 1203 CG17109-PB 1..906 17..925 835 73 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:15:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG6738-RA 1291 CG6738-RA 42..1244 17..1219 6015 100 Plus
CG6733-RA 1291 CG6733-RA 26..1234 11..1219 1695 76 Plus
CG17109-RB 1373 CG17109-RB 44..949 17..925 835 73 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:15:27
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 23099719..23100210 108..599 2460 100 Plus
3R 32079331 3R 23100264..23100682 600..1018 2095 100 Plus
3R 32079331 3R 23100735..23100936 1018..1219 1010 100 Plus
3R 32079331 3R 23097907..23098397 108..598 820 77.8 Plus
3R 32079331 3R 23098460..23098876 602..1018 525 75.1 Plus
3R 32079331 3R 23096451..23096757 619..925 455 76.5 Plus
3R 32079331 3R 23099574..23099664 17..107 455 100 Plus
3R 32079331 3R 23095963..23096326 191..554 425 74.5 Plus
3R 32079331 3R 23098977..23099134 1062..1219 295 79.1 Plus
3R 32079331 3R 23092756..23092922 755..921 235 76 Plus
3R 32079331 3R 23092179..23092417 231..469 205 72.4 Plus
3R 32079331 3R 23093972..23094091 250..369 195 77.5 Plus
Blast to na_te.dros performed on 2014-11-27 07:15:28 has no hits.

BO30135.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-12 10:52:43 Download gff for BO30135.complete
Subject Subject Range Query Range Percent Splice Strand
CG6738-RA 39..1241 17..1221 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:10:09 Download gff for BO30135.complete
Subject Subject Range Query Range Percent Splice Strand
CG6738-RA 42..1244 17..1221 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:06:49 Download gff for BO30135.complete
Subject Subject Range Query Range Percent Splice Strand
CG6738-RA 42..1244 17..1221 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:06:49 Download gff for BO30135.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23100735..23100936 1018..1221 99   Plus
3R 23100264..23100681 600..1017 100 -> Plus
3R 23099719..23100210 108..599 100 -> Plus
3R 23099574..23099664 17..107 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:10:09 Download gff for BO30135.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 18926457..18926658 1018..1221 99   Plus
arm_3R 18925986..18926403 600..1017 100 -> Plus
arm_3R 18925441..18925932 108..599 100 -> Plus
arm_3R 18925296..18925386 17..107 100 -> Plus

BO30135.pep Sequence

Translation from 16 to 1237

> BO30135.pep
MSAEKWEKNEEIRIFREYLRIPSVHPNIDYTACVEFIKRQADSLNLPVEV
VFPAVKSKPVVIIKWEGSQPKLPSIILSSHMDVVPVFPEMWTHEPFSADI
DEEGRIFARGAQDMKSVGTQYLGAIRLLRADGFQPKRTLYVTFVPDEEIG
GIHGMAAFVETDFYKQMNVGFSLDEGGTSASDVHHLFYAERIRWILKLKV
AGTAGHGSLLLPDTAGVKLNYVLNKLTEFRESQIQRLKNDKSLSIGDVTT
VNLTQLSGGVQSNVVPPLFEAIFDIRLAITLDLVAFEREIRNWCEEAGGG
IDIEFPLKEAYVAATRLDDSNPYWLALKVALDELGLKVKPIVCFAVTDCR
FIRQQGTPAIGFSPIINTTVLIHDHDEFLRADDYLNGIQVYKKIIPNLTE
VASFLDH

BO30135.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:09:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG6738-PA 401 CG6738-PA 1..401 1..401 2080 100 Plus
CG6733-PA 401 CG6733-PA 1..401 1..401 1700 79.3 Plus
CG17109-PB 400 CG17109-PB 1..400 1..401 1565 72.8 Plus
CG17109-PA 400 CG17109-PA 1..400 1..401 1565 72.8 Plus
CG6726-PC 401 CG6726-PC 1..400 1..400 1480 66.5 Plus