Clone BO30139 Report

Search the DGRC for BO30139

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:301
Well:39
Vector:pDNR-Dual
Associated Gene/TranscriptCG5830-RA
Protein status:BO30139.pep: Imported from assembly
Sequenced Size:1021

Clone Sequence Records

BO30139.complete Sequence

1021 bp assembled on 2011-09-12

GenBank Submission: KX794250

> BO30139.complete
GAAGTTATCAGTCGACATGGATGCAACATCAATAATAACGCAAGTTTCCC
GCGACGACGAGCAACTGAACGTCTATCCCAGCTATCCCAATGACAAAGAC
GATGTGGATCGTTTAAAGCCACAGAAGCGAGGATTATTCCATTCTCTGCT
TTGCTGCTGGCGACGAAACCGAACGAAAACCAACCAGAATGGCACACAAA
TCGATGGATCGACAACACCGCCACCATTACCGGACCAACAAAGGTACCTA
CTACCTCAGGTTAGGCTTACCGATATGCACAGAAAGTGCATGGTGATCGA
TTTGGATGAGACCCTAGTGCACAGTAGTTTTAAGCCCATACCGAATGCTG
ATTTCATAGTGCCCGTGGAGATCGATGGAACCGTACATCAGGTGTACGTC
CTGAAGCGACCGCACGTGGACGAGTTTCTGCAGAAGATGGGCGAACTATA
CGAGTGCGTTCTGTTCACAGCATCACTAGCCAAATACGCAGATCCCGTCG
CCGATCTGTTAGACAAGTGGAATGTGTTTCGTGCAAGACTGTTTAGGGAA
TCATGCGTTTATTACAGGGGTAATTACATTAAGGATCTGAATCGTCTGGG
GCGGGACCTTCAGAAGATTGTCATTGTCGACAATTCACCGGCCAGTTATA
TCTTTCATCCAGACAATGCAGTTCCTGTTAAATCCTGGTTTGACGATGTC
ACCGACTGCGAACTGCGCGAACTGATCCCGCTCTTTGAGAAGCTTAGCAA
AGTTGATTCCGTCTACTCGGTGCTCTGCAATTCGAACCAGCCGCTGAACA
ATCAGACAAACCAGCAGCAGCATCCCCAGGAACTGCAGCAGGCGCCGAAC
CAGCTGCATCAGCAGCTCCAACAGCAGCAACAACAACAGACCATCTCTGC
CACGACAGTTATTACCCAGGCAACCACATTGTCTGCTCCGACCATGTTGA
ACCAGCAGCAGACAAGTCCGCCCAGCCCACAAAGCGAGTTGCTGCAAAAG
ACGGCAAGCTTTCTAGACCAT

BO30139.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:19:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG5830-RA 990 CG5830-PA 1..987 17..1003 4935 100 Plus
CG5830-RB 1059 CG5830-PB 152..1056 99..1003 4525 100 Plus
CG5830-RB 1059 CG5830-PB 1..85 17..101 425 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:19:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG5830-RA 3534 CG5830-RA 483..1469 17..1003 4935 100 Plus
CG5830-RB 3603 CG5830-RB 634..1538 99..1003 4525 100 Plus
CG5830-RB 3603 CG5830-RB 483..567 17..101 425 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:19:03
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 15994734..15995066 1003..671 1665 100 Minus
3L 28110227 3L 15995610..15995847 334..97 1190 100 Minus
3L 28110227 3L 15995355..15995541 519..333 935 100 Minus
3L 28110227 3L 15995133..15995288 672..517 780 100 Minus
3L 28110227 3L 16003899..16003980 98..17 410 100 Minus
Blast to na_te.dros performed 2014-11-27 07:19:05
Subject Length Description Subject Range Query Range Score Percent Strand
roo 9092 roo DM_ROO 9092bp 1059..1181 786..913 231 69 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6769..6918 784..928 224 64 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6720..6879 798..960 222 62.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6784..6907 784..908 217 64.8 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2321..2471 808..965 216 62.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6727..6832 784..889 215 67 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2326..2507 786..961 210 62 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6748..6850 784..889 208 67.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6841..6923 806..887 205 73.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2307..2422 812..928 204 65 Plus
roo 9092 roo DM_ROO 9092bp 1057..1152 811..907 194 70.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2447..2653 806..1006 172 59 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1517..1627 811..919 171 64 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2372..2476 784..888 165 61.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6714..6844 831..965 159 61.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2721..2833 786..896 155 64.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1497..1576 806..888 154 71.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2590..2665 810..888 154 68.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2818..2922 786..887 149 61.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2306..2374 814..888 145 70.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2748..2851 827..928 145 62.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2893..2986 794..888 139 62.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6720..6828 849..960 137 62.8 Plus
roo 9092 roo DM_ROO 9092bp 1049..1140 840..928 136 65.2 Plus
Dvir\Het-A 6610 Dvir\Het-A HETAVIR 6610bp 3285..3322 851..888 136 84.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2310..2363 836..889 135 72.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6723..6799 831..908 135 67.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1517..1595 850..928 133 67.9 Plus
gypsy11 4428 gypsy11 GYPSY11 4428bp 967..1010 846..889 130 77.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6720..6789 858..928 127 66.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2306..2348 847..889 125 76.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1555..1594 810..849 119 77.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2306..2341 853..888 117 80.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2587..2661 828..895 115 68 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6464..6556 796..892 114 63.3 Plus

BO30139.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-12 10:52:46 Download gff for BO30139.complete
Subject Subject Range Query Range Percent Splice Strand
CG5830-RA 482..1468 17..1005 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:11:48 Download gff for BO30139.complete
Subject Subject Range Query Range Percent Splice Strand
CG5830-RA 483..1469 17..1005 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:08:09 Download gff for BO30139.complete
Subject Subject Range Query Range Percent Splice Strand
CG5830-RA 483..1469 17..1005 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:08:09 Download gff for BO30139.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16003899..16003980 17..98 100   Minus
3L 15995610..15995845 99..334 100 <- Minus
3L 15995358..15995539 335..516 100 <- Minus
3L 15995135..15995288 517..670 100 <- Minus
3L 15994732..15995066 671..1005 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:11:48 Download gff for BO30139.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 15996999..15997080 17..98 100   Minus
arm_3L 15988710..15988945 99..334 100 <- Minus
arm_3L 15988458..15988639 335..516 100 <- Minus
arm_3L 15988235..15988388 517..670 100 <- Minus
arm_3L 15987832..15988166 671..1005 99 <- Minus

BO30139.pep Sequence

Translation from 16 to 1021

> BO30139.pep
MDATSIITQVSRDDEQLNVYPSYPNDKDDVDRLKPQKRGLFHSLLCCWRR
NRTKTNQNGTQIDGSTTPPPLPDQQRYLLPQVRLTDMHRKCMVIDLDETL
VHSSFKPIPNADFIVPVEIDGTVHQVYVLKRPHVDEFLQKMGELYECVLF
TASLAKYADPVADLLDKWNVFRARLFRESCVYYRGNYIKDLNRLGRDLQK
IVIVDNSPASYIFHPDNAVPVKSWFDDVTDCELRELIPLFEKLSKVDSVY
SVLCNSNQPLNNQTNQQQHPQELQQAPNQLHQQLQQQQQQQTISATTVIT
QATTLSAPTMLNQQQTSPPSPQSELLQKTASFLDH

BO30139.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:09:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG5830-PA 329 CG5830-PA 1..329 1..329 1738 100 Plus
CG5830-PB 352 CG5830-PB 1..352 1..329 1704 93.5 Plus
Dd-PB 240 CG1696-PB 51..230 83..253 358 43.3 Plus
Dd-PA 243 CG1696-PA 54..233 83..253 358 43.3 Plus
CG8584-PA 293 CG8584-PA 89..275 83..253 286 37.4 Plus