Clone BO30145 Report

Search the DGRC for BO30145

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:301
Well:45
Vector:pDNR-Dual
Associated Gene/TranscriptRox8-RD
Protein status:BO30145.pep: Imported from assembly
Sequenced Size:1444

Clone Sequence Records

BO30145.complete Sequence

1444 bp assembled on 2011-09-12

GenBank Submission: KX795125

> BO30145.complete
GAAGTTATCAGTCGACATGGACGAGTCGCAACCGAAGACCCTATACGTGG
GCAACCTGGATAGCTCAGTGTCCGAGGACCTGCTAATTGCCCTCTTCAGC
ACCATGGGGCCCGTCAAAAGCTGCAAAATCATTCGGGAACCGGGCAACGA
TCCATATGCCTTCATCGAATATTCCAACTACCAGGCAGCCACAACAGCTC
TGACCGCCATGAATAAACGCCTATTCCTCGAAAAGGAAATCAAGGTCAAC
TGGGCCACCAGTCCCGGCAATCAGCCGAAGACAGACATCAGTTCGCACCA
CCACATATTCGTGGGCGACCTCAGTCCCGAGATTGAGACAGAAACACTGC
GCGAGGCTTTCGCCCCATTCGGAGAGATCTCCAACTGTCGCATTGTGCGC
GACCCTCACACCATGAAGTCAAAGGGTTACGCCTTCGTGTCGTTTGTGAA
AAAGGCGGAGGCAGAGAACGCCATCCAGGCGATGAACGGCCAGTGGATTG
GCTCGCGCTCGATACGCACCAACTGGTCCACGCGCAAGCTGCCACCACCA
CGCGAGCCTTCCAAGGGCGGAGGCCAGGGAGGCGGAATGGGTGGCGGACC
GGGCAATGGGTCCGGTGTAAAGGGAAGTCAACGCCACACCTTCGAGGAAG
TGTATAACCAGTCGAGCCCCACCAACACCACCGTATACTGTGGCGGATTC
CCGCCGAATGTCATCAGTGACGACCTGATGCACAAGCACTTCGTCCAGTT
TGGTCCCATCCAGGACGTGCGGGTCTTCAAGGACAAGGGCTTCTCGTTCA
TCAAGTTTGTTACCAAGGAGGCAGCCGCCCACGCCATCGAGCACACGCAC
AACAGCGAGGTACATGGAAACCTGGTAAAGTGCTTCTGGGGCAAAGAGAA
CGGAGGCGATAACTCGGCCAATAACCTCAATGCCGCCGCTGCCGCGGCAG
CAGCCTCTGCCAATGTTGCCGCCGTTGCGGCAGCCAATGCTGCGGTTGCC
GCTGGAGCGGGTATGCCCGGTCAGATGATGACGCAGCAACAGATCGCCGC
CGCAACAGGAGCGGCGATACCCGGCCAAATGATGACACCCCAGCAGATTG
CGGCGCAGTATCCATACGCGTACCAGCAGATGGGCTACTGGTATCCACCT
GCGACTTATCCCACAACCCAGATGCAGACGCAATACATGCAGCAGGGCTA
CTATCCCTACGCCTACCCTACCAGTGCTCAGCAAGCGGGAGGAGTCCCTT
GCATACAATTTTCAGCGGCTGGATACCGCATGGTGCCGCCGAATGTAGCA
TGGGGCGTGCCCGGAACTGTGGTGCCCGGTGTGACGGCTGCCGCAGCATC
CGCGGCCGCTGCAGCGAACGGATCACTTGCCCCCCAAATGATGTACAGTG
CTGCGATGCCACAATACCAGACCCAAGCAAGCTTTCTAGACCAT

BO30145.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:19:39
Subject Length Description Subject Range Query Range Score Percent Strand
Rox8-RH 1413 CG5422-PH 1..1410 17..1426 7050 100 Plus
Rox8-RG 1413 CG5422-PG 1..1410 17..1426 7050 100 Plus
Rox8-RE 1413 CG5422-PE 1..1410 17..1426 7050 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:19:40
Subject Length Description Subject Range Query Range Score Percent Strand
Rox8-RH 3370 CG5422-RH 1049..2459 16..1426 7055 100 Plus
Rox8-RG 3328 CG5422-RG 1007..2417 16..1426 7055 100 Plus
Rox8-RE 3222 CG5422-RE 901..2311 16..1426 7055 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:19:37
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 24044358..24045268 1153..243 4555 100 Minus
3R 32079331 3R 24045436..24045666 246..16 1155 100 Minus
3R 32079331 3R 24043967..24044145 1426..1248 895 100 Minus
3R 32079331 3R 24044197..24044291 1247..1153 475 100 Minus
Blast to na_te.dros performed on 2014-11-27 07:19:38 has no hits.

BO30145.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-12 10:52:48 Download gff for BO30145.complete
Subject Subject Range Query Range Percent Splice Strand
Rox8-RD 980..2389 17..1428 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:12:04 Download gff for BO30145.complete
Subject Subject Range Query Range Percent Splice Strand
Rox8-RE 902..2311 17..1428 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:08:18 Download gff for BO30145.complete
Subject Subject Range Query Range Percent Splice Strand
Rox8-RE 902..2311 17..1428 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:08:18 Download gff for BO30145.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24045438..24045665 17..244 100   Minus
3R 24044358..24045266 245..1153 100 <- Minus
3R 24044197..24044290 1154..1247 100 <- Minus
3R 24043964..24044145 1248..1428 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:12:04 Download gff for BO30145.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 19871160..19871387 17..244 100   Minus
arm_3R 19870080..19870988 245..1153 100 <- Minus
arm_3R 19869919..19870012 1154..1247 100 <- Minus
arm_3R 19869686..19869867 1248..1428 98 <- Minus

BO30145.pep Sequence

Translation from 16 to 1444

> BO30145.pep
MDESQPKTLYVGNLDSSVSEDLLIALFSTMGPVKSCKIIREPGNDPYAFI
EYSNYQAATTALTAMNKRLFLEKEIKVNWATSPGNQPKTDISSHHHIFVG
DLSPEIETETLREAFAPFGEISNCRIVRDPHTMKSKGYAFVSFVKKAEAE
NAIQAMNGQWIGSRSIRTNWSTRKLPPPREPSKGGGQGGGMGGGPGNGSG
VKGSQRHTFEEVYNQSSPTNTTVYCGGFPPNVISDDLMHKHFVQFGPIQD
VRVFKDKGFSFIKFVTKEAAAHAIEHTHNSEVHGNLVKCFWGKENGGDNS
ANNLNAAAAAAAASANVAAVAAANAAVAAGAGMPGQMMTQQQIAAATGAA
IPGQMMTPQQIAAQYPYAYQQMGYWYPPATYPTTQMQTQYMQQGYYPYAY
PTSAQQAGGVPCIQFSAAGYRMVPPNVAWGVPGTVVPGVTAAAASAAAAA
NGSLAPQMMYSAAMPQYQTQASFLDH

BO30145.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:10:01
Subject Length Description Subject Range Query Range Score Percent Strand
Rox8-PH 470 CG5422-PH 1..470 1..470 2487 100 Plus
Rox8-PG 470 CG5422-PG 1..470 1..470 2487 100 Plus
Rox8-PE 470 CG5422-PE 1..470 1..470 2487 100 Plus
Rox8-PD 470 CG5422-PD 1..470 1..470 2487 100 Plus
Rox8-PC 464 CG5422-PC 1..464 1..470 2438 98.7 Plus