Clone BO30146 Report

Search the DGRC for BO30146

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:301
Well:46
Vector:pDNR-Dual
Associated Gene/TranscriptCG3305-RA
Protein status:BO30146.pep: Imported from assembly
Sequenced Size:988

Clone Sequence Records

BO30146.complete Sequence

988 bp assembled on 2011-09-12

GenBank Submission: KX796781

> BO30146.complete
GAAGTTATCAGTCGACATGTTCGCCAACAAATTGTTGACCTGCTCGGCAT
TACTAATAATGTTATTTTTACTAAGCAGTACAGTGTTCTCTCAAAAGCTT
ATTGGCTTGCCGAGAGTCGGTAAAAATGTTAGTGATTTGTTTCTGGAACA
AGCAAACCCACTGACCAGCAGCTCCTCAACAATCTCAACGTCTTCGACAA
CAACTGAGAAACCTATCACAACCAGATCAACTTCTACAATAACTCCGAGA
TCTACCACACCTTCAACGGAATCACCATCGACCACCGCACCAGTGATAAG
CACGACCATTGCCCCGCAACCATATCCGCAACCATCCATTGGGGCTTGGA
ATACCTCTTGTATTATGCTTCAAATGGCGGCACAACTTAATTTTACCTAT
GAGGCTAGGGAGGGAAACTTTACCACCGGTCTGTACAACATCCCCAGCAA
CGCATCTGTTGAAGATGCAGAATGTAAAAGCCAGACTACTCAGTTTATTC
ATCTGATTTGGGGACCAGAAACATCAAAGCAATCATTAATTATGTATTTT
AATAAAAGTAATGACACCACTGTGCTTTCCTTTATGCAAATTCATCTGGC
TTTGCTGCCTGAGGATTTTCCAGATGCAAAGGAAAATCAAACGGTTCAGC
TTATTACCAGGAGCGACGGAGCGTTTAAGACACCAGAAAATATGTCGTAT
CACTGCACTCGTGTTCAGAAGATAAATATGACTGAGACACTCGATGCTGA
GCAGTTAATTGGTTGGATCAGCGTCAGTCATGTTCAGGTGGAGGCTTTCC
GGAGGGCCAACGACACTGGTTTCTCAGTTGGACACGATTGCGATAGCTCG
GAAACTTCGGATGTGGTTCCCATTGCCGTTGGAATTGCTTTAGCTGCATT
AATTTTGGTGGTATTAATATCATATCTGTGTGCTAGGCGTCGTTCCACCT
CCCGCGGTTACATGAGCTTCGCAAGCTTTCTAGACCAT

BO30146.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:18:31
Subject Length Description Subject Range Query Range Score Percent Strand
Lamp1-RA 957 CG3305-PA 1..954 17..970 4770 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:18:32
Subject Length Description Subject Range Query Range Score Percent Strand
Lamp1-RA 1583 CG3305-RA 107..1060 17..970 4770 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:18:29
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 21576242..21576580 632..970 1695 100 Plus
2L 23513712 2L 21574785..21575113 82..410 1645 100 Plus
2L 23513712 2L 21575964..21576186 410..632 1115 100 Plus
2L 23513712 2L 21573495..21573561 17..83 335 100 Plus
Blast to na_te.dros performed on 2014-11-27 07:18:30 has no hits.

BO30146.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-12 10:52:46 Download gff for BO30146.complete
Subject Subject Range Query Range Percent Splice Strand
CG3305-RA 123..1071 22..972 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:11:33 Download gff for BO30146.complete
Subject Subject Range Query Range Percent Splice Strand
Lamp1-RA 112..1060 22..972 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:07:58 Download gff for BO30146.complete
Subject Subject Range Query Range Percent Splice Strand
Lamp1-RA 112..1060 22..972 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:07:58 Download gff for BO30146.complete
Subject Subject Range Query Range Percent Splice Strand
2L 21576243..21576580 633..972 99   Plus
2L 21575965..21576186 411..632 100 -> Plus
2L 21574787..21575113 84..410 100 -> Plus
2L 21573500..21573561 22..83 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:11:33 Download gff for BO30146.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 21576243..21576580 633..972 99   Plus
arm_2L 21575965..21576186 411..632 100 -> Plus
arm_2L 21574787..21575113 84..410 100 -> Plus
arm_2L 21573500..21573561 22..83 100 -> Plus

BO30146.pep Sequence

Translation from 16 to 988

> BO30146.pep
MFANKLLTCSALLIMLFLLSSTVFSQKLIGLPRVGKNVSDLFLEQANPLT
SSSSTISTSSTTTEKPITTRSTSTITPRSTTPSTESPSTTAPVISTTIAP
QPYPQPSIGAWNTSCIMLQMAAQLNFTYEAREGNFTTGLYNIPSNASVED
AECKSQTTQFIHLIWGPETSKQSLIMYFNKSNDTTVLSFMQIHLALLPED
FPDAKENQTVQLITRSDGAFKTPENMSYHCTRVQKINMTETLDAEQLIGW
ISVSHVQVEAFRRANDTGFSVGHDCDSSETSDVVPIAVGIALAALILVVL
ISYLCARRRSTSRGYMSFASFLDH

BO30146.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:09:51
Subject Length Description Subject Range Query Range Score Percent Strand
Lamp1-PA 318 CG3305-PA 1..318 1..318 1616 100 Plus