Clone BO30152 Report

Search the DGRC for BO30152

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:301
Well:52
Vector:pDNR-Dual
Associated Gene/Transcriptalc-RA
Protein status:BO30152.pep: Imported from assembly
Sequenced Size:1057

Clone Sequence Records

BO30152.complete Sequence

1057 bp assembled on 2011-09-12

GenBank Submission: KX793924

> BO30152.complete
GAAGTTATCAGTCGACATGGGCAACGCCAGCTCCTCCGTGCACATGCAAC
GCGAGCGCCACAAGTCGACCGACTTGTCCACGCCGAGCTCTCCCGCACAT
TTCCGCGATTCGATTGGTGGAGGAGGAGCGGGACAGGGCGGGAGTGCTGG
CGCAGCAGCTCTGGGCGCTGCAGCGGGGGCGGTGGGAGCTGCGGGGGGTG
GAGGAGGAGGCGGCGGAGGCCAAGCTTTCTCGTTCGACAAAAAACATACG
GCAGTCTTGAACGAGGGCTCGTCGCAAGAAGACGACGACCCGTACTACAC
GGGAACTGGAACTGGATCCACTAGACGAGGCACCGCACACGACGACGCTA
CATCAGCTGTTACCCGAGACCACTCCAGCATGGACAACAACGAGGAGGAG
GAGGAGGCAGCGGTAGGAGCGGAGCCAGCGACTGGATCTCAGTTAACCGG
CGATGAGGACGACATCCGGAAGACGGCACTGCCCACAGTTCTGCGGTGGG
ACGGCGGCGGCAAGAACGTCACCATCTCGGGCACATTCTCCGATTGGAAG
CCCATGGCCATGGTGCGCAGCCATCAGAACTTCGTGACCATCATAGATCT
GCCGGAGGGCGACCATCAGTACAAGTTCTGCGTGGACGGCGAGTGGAAGC
ACGATCCCAAGCTGAAAAGCGTGGAGAACGCCGAGGGACAGAGAAATAAC
TTAGTGTCCGTGCGAGAATCCGATTTCGAGGTGTTCCAGGCCCTAGCCAA
AGACAGCGAGAACGTGACCAACTATGCGGAGAAGGAGTACTCGCAGGAGG
TGCCGCAGGTGAAGCCCTGGGAGAAGGTATCTGGCCCGCCCGTTCTGCCG
CCCCATCTGCTCCAGGTCATCCTCAACAAGGATACACCGCTATCGTGTGA
ACCCACTCTGCTGCCGGAACCCAACCACGTGATGCTTAACCACTTGTACG
CCCTGTCTATCAAGGATGGCGTCATGGTCCTGAGTGCCACGCACAGGTAT
CGCAAGAAGTACGTCACCACGCTGCTGTACAAGCCCATTGCAAGCTTTCT
AGACCAT

BO30152.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:34:54
Subject Length Description Subject Range Query Range Score Percent Strand
alc-RA 1026 CG8057-PA 1..1023 17..1039 5100 99.9 Plus
alc-RB 663 CG8057-PB 1..660 380..1039 3300 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:34:56
Subject Length Description Subject Range Query Range Score Percent Strand
alc-RA 1544 CG8057-RA 334..1357 16..1039 5105 99.9 Plus
alc-RB 981 CG8057-RB 1..794 246..1039 3955 99.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 06:34:52
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 9136952..9137600 664..16 3230 99.8 Minus
2R 25286936 2R 9135765..9135996 895..664 1160 100 Minus
2R 25286936 2R 9135562..9135706 1039..895 725 100 Minus
Blast to na_te.dros performed on 2014-11-27 06:34:53 has no hits.

BO30152.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-12 10:52:50 Download gff for BO30152.complete
Subject Subject Range Query Range Percent Splice Strand
alc-RA 352..1374 17..1041 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:47:16 Download gff for BO30152.complete
Subject Subject Range Query Range Percent Splice Strand
alc-RA 335..1357 17..1041 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:48:48 Download gff for BO30152.complete
Subject Subject Range Query Range Percent Splice Strand
alc-RA 335..1357 17..1041 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 07:48:48 Download gff for BO30152.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9136952..9137599 17..664 99   Minus
2R 9135765..9135995 665..895 100 <- Minus
2R 9135560..9135705 896..1041 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:47:16 Download gff for BO30152.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 5024457..5025104 17..664 99   Minus
arm_2R 5023270..5023500 665..895 100 <- Minus
arm_2R 5023065..5023210 896..1041 98 <- Minus

BO30152.pep Sequence

Translation from 16 to 1057

> BO30152.pep
MGNASSSVHMQRERHKSTDLSTPSSPAHFRDSIGGGGAGQGGSAGAAALG
AAAGAVGAAGGGGGGGGGQAFSFDKKHTAVLNEGSSQEDDDPYYTGTGTG
STRRGTAHDDATSAVTRDHSSMDNNEEEEEAAVGAEPATGSQLTGDEDDI
RKTALPTVLRWDGGGKNVTISGTFSDWKPMAMVRSHQNFVTIIDLPEGDH
QYKFCVDGEWKHDPKLKSVENAEGQRNNLVSVRESDFEVFQALAKDSENV
TNYAEKEYSQEVPQVKPWEKVSGPPVLPPHLLQVILNKDTPLSCEPTLLP
EPNHVMLNHLYALSIKDGVMVLSATHRYRKKYVTTLLYKPIASFLDH

BO30152.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:10:10
Subject Length Description Subject Range Query Range Score Percent Strand
alc-PA 341 CG8057-PA 1..341 1..341 1801 100 Plus
alc-PB 220 CG8057-PB 1..220 122..341 1170 100 Plus