Clone BO30153 Report

Search the DGRC for BO30153

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:301
Well:53
Vector:pDNR-Dual
Associated Gene/TranscriptCG5807-RA
Protein status:BO30153.pep: Imported from assembly
Sequenced Size:1615

Clone Sequence Records

BO30153.complete Sequence

1615 bp assembled on 2011-09-12

GenBank Submission: KX795656

> BO30153.complete
GAAGTTATCAGTCGACATGGACGAAGAGGAGGAGGAGGAGGTTACGGATC
TAAAGCTGCAATTGTTCCACAATACAGTACGCGAGCACATTATATTCTTG
CTACTGATAATCTTGCTGTACTCCAGCTCCTATGTGGTCGTCTCACGTTT
TAGGCGGCGCGACCGTGACGATCTCTATTCGAATGACGAGGACGAGGTGC
TGGTCTATCGCATAAGCTTTTGGCTGTGCACATTCACACTGGCCGTTGCC
GAAGGGGCTGCCATGCTGCTGCCCGTTTCCATTGCCAGCAATGAGGTGCT
ACTCCTCTATCCCAACAGTTACTATGTGAAATGGCTAAACAGTTCACTCA
TACAGGGCTTGTGGAACCATGTATTTCTGTTCTCCAATCTGTCACTGTTC
ATCTTCCTGCCATTTGTCTATTTGTTCTCGGAATCCACGGGATTCGTCGG
CAACAAGAAGGGCATCCTGCCGCGAGTCTACGAAACCTTTACAGTATTTA
TGCTGATGGCCATTATTGTCCTCGTACTAACTGCCGTCCTAAGTGCAGTC
TTTGGCATTGAAAAGCTTCAATTCTTCTGGTTTCTAAATTTGGGCAGTGT
TCACCTGCCGTTTCTTTATTCGTGTGTCTCGTTTTTGGGTGTCATGCTTA
TGCTGATTTGCACCCCGTATGGCTTTGTGCGCCTCTTTGGCGTTGTTAAC
CAGGTGCTGGTGCGACCTATGCTACTGCGCGACGTCAACGAGGAGTTTAG
CGCCTTCTACATGGAGGAAGCAAGCGTGAAGCGGAAGCTAGCGCACATTG
AGCTGCACAACGTGAGCATTGCGGATGCCGCCAACGGAGGTCGCCTTGGC
AATCGGATTGGTCTGGGACGTGGGCGCACCTTCTATCCCCAGCCACTGCT
GCAACACTCCCAGGCTCATCTATACCAGCGCAAGGCGATGGCCAGTGACG
TGGACGAGCTCAACGATAGACTAAGAGAACTGGACTCCGAGCGCAAGGAA
CTAGACAAGCTGCGCACATCGAGCACCTTCCAACGCACATTCGTCTATCC
GCTGGCCATGCTGCTGCTGCTCTTCTGCACAGCTGTCACCATTCTGCTGG
TTGTGCAGAATACACTAGAGCTCCTTATTGGCATTAAGGCGCTGCCACTA
AGCACAAGGCAATTCGCATTGGGCATCTCTTCGCTCTCGAAGTTGGGTCC
CTTTGGTGCCGGCCTGGAGGTGTGTCTCATCTTCTATCTCGGCGCCACCT
CGGTGGTGGGCTTCTACAGCATGCCGTTCATGCGCAAGGTTTGTCCCAAG
CGGCGCCAGACTTCGCTGCCACAGCTAATGCTGAACTGTGGCTTCATGCT
GGTTTTGTCGTCGGCATTGCCGCTTCTCAGCAGGATCATAGGCATCACAA
ACTTTGACCTGCTGGGTGATTTTGGAGCCATCGAGTGGTTGGGAAACTTC
CAGATTGTATTGCTTTACAATTTGGTTTTTGGAACCACAACTGCCCTGTG
CTTGGCAAACAAATTCACGGCTACGGTGCGCCGGGAGCTAAGAGCCCGGT
TAGTGGAGAACTATGTGCTCTTTACTAACTACATTAGCTTCATCAACGCA
AGCTTTCTAGACCAT

BO30153.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:35:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG5807-RA 1584 CG5807-PA 1..1581 17..1597 7875 99.9 Plus
CG5807-RB 1560 CG5807-PB 1..1532 17..1548 7630 99.9 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:35:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG5807-RA 2690 CG5807-RA 362..1943 16..1597 7880 99.9 Plus
CG5807-RB 2035 CG5807-RB 362..1894 16..1548 7635 99.9 Plus
CG6980-RA 927 CG6980-RA 847..915 656..588 345 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 06:35:22
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 24806978..24807480 1159..657 2485 99.6 Minus
3R 32079331 3R 24806685..24806918 1392..1159 1170 100 Minus
3R 32079331 3R 24808815..24809046 587..356 1160 100 Minus
3R 32079331 3R 24806414..24806621 1597..1390 1040 100 Minus
3R 32079331 3R 24809105..24809247 357..215 715 100 Minus
3R 32079331 3R 24809362..24809486 216..92 625 100 Minus
3R 32079331 3R 24813576..24813651 91..16 380 100 Minus
3R 32079331 3R 24808597..24808665 656..588 345 100 Minus
Blast to na_te.dros performed on 2014-11-27 06:35:23 has no hits.

BO30153.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-12 10:52:51 Download gff for BO30153.complete
Subject Subject Range Query Range Percent Splice Strand
CG5807-RA 379..1959 17..1599 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:47:33 Download gff for BO30153.complete
Subject Subject Range Query Range Percent Splice Strand
CG5807-RA 363..1943 17..1599 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:49:01 Download gff for BO30153.complete
Subject Subject Range Query Range Percent Splice Strand
CG5807-RA 363..1943 17..1599 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 07:49:01 Download gff for BO30153.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24813576..24813650 17..91 100   Minus
3R 24809362..24809486 92..216 100 <- Minus
3R 24809106..24809245 217..356 100 <- Minus
3R 24808815..24809045 357..587 100 <- Minus
3R 24808597..24808665 588..656 100 <- Minus
3R 24806978..24807480 657..1159 99 <- Minus
3R 24806686..24806917 1160..1391 100 <- Minus
3R 24806411..24806619 1392..1599 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:47:33 Download gff for BO30153.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 20639298..20639372 17..91 100   Minus
arm_3R 20635084..20635208 92..216 100 <- Minus
arm_3R 20634828..20634967 217..356 100 <- Minus
arm_3R 20634537..20634767 357..587 100 <- Minus
arm_3R 20634319..20634387 588..656 100 <- Minus
arm_3R 20632700..20633202 657..1159 99 <- Minus
arm_3R 20632408..20632639 1160..1391 100 <- Minus
arm_3R 20632133..20632341 1392..1599 99 <- Minus

BO30153.pep Sequence

Translation from 16 to 1615

> BO30153.pep
MDEEEEEEVTDLKLQLFHNTVREHIIFLLLIILLYSSSYVVVSRFRRRDR
DDLYSNDEDEVLVYRISFWLCTFTLAVAEGAAMLLPVSIASNEVLLLYPN
SYYVKWLNSSLIQGLWNHVFLFSNLSLFIFLPFVYLFSESTGFVGNKKGI
LPRVYETFTVFMLMAIIVLVLTAVLSAVFGIEKLQFFWFLNLGSVHLPFL
YSCVSFLGVMLMLICTPYGFVRLFGVVNQVLVRPMLLRDVNEEFSAFYME
EASVKRKLAHIELHNVSIADAANGGRLGNRIGLGRGRTFYPQPLLQHSQA
HLYQRKAMASDVDELNDRLRELDSERKELDKLRTSSTFQRTFVYPLAMLL
LLFCTAVTILLVVQNTLELLIGIKALPLSTRQFALGISSLSKLGPFGAGL
EVCLIFYLGATSVVGFYSMPFMRKVCPKRRQTSLPQLMLNCGFMLVLSSA
LPLLSRIIGITNFDLLGDFGAIEWLGNFQIVLLYNLVFGTTTALCLANKF
TATVRRELRARLVENYVLFTNYISFINASFLDH

BO30153.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:10:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG5807-PA 527 CG5807-PA 1..527 1..527 2671 100 Plus
CG5807-PB 519 CG5807-PB 1..518 1..518 2598 99 Plus