Clone BO30156 Report

Search the DGRC for BO30156

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:301
Well:56
Vector:pDNR-Dual
Associated Gene/Transcriptwun2-RA
Protein status:BO30156.pep: Imported from assembly
Sequenced Size:1084

Clone Sequence Records

BO30156.complete Sequence

1084 bp assembled on 2011-09-12

GenBank Submission: KX797869

> BO30156.complete
GAAGTTATCAGTCGACATGAGCACCCTGCGACCCGTCAGCGTTTGCGATA
CCACGCCGCTCCAGAGATTCGAGAGCCAGAGCAGCAGCGGTGAAGAGCCT
TCTTCGCCGACGGCTTCCAGTATTATAGCCGCCGCTTCAGGCCCCAATCA
CAACAACAACAACAATGTGAAACTTGACCTGCAGCTGCCCACCTTCGTTG
ATAGCACCCGTAGCCAGGGTTCACTGTACGCGGTAGCCAGCAACAAGAAG
CCACCGCTGCGTGGACCACGACAAATCTTCGGAAGGATCCTCACGGACCT
CTGTTTGCTCAGCTGCGTTGGTCTACCTATGCTGGGATTTTCGCTTTGGG
GCGAAGCGGTTAAGCGCGGATTCTTCTGCGATGATTCCTCCTTGAGGCAT
CCATATCGAGACTCCACCATGCCCAGTTGGATTCTCTACTTGATGTGTGG
CGCCTTGCCTCTTACTGTGATGCTTGTGGTGGAGTTCTTTAGAGGACAGG
ACAAGCGATTGCACAGTCCATTTCCGAAGAGCACGATGTGCAGTGGCTAT
CATCTGTGCCACTTGGAGCTGCCCACTTGGCTGGTGGAGTGCTACCACAG
GATGGGTATCTTTATCTTCGGATTGGGCGTAGAGCAGCTATCCACGAACA
TCGCCAAGTATTCCATTGGACGGCTGAGACCTCACTTCTACACACTCTGT
CAGCCCGTCATGAAAGATGGCACCACTTGCAGTGATCCCATTAACGCTGC
TCGTTACATCGAGGAGTTCACCTGTGCGGCGGTGGACATTACATCGAAGC
AGCTAAAGGACATGCGCCTGTCCTTTCCCAGTGGACATGCTAGCTTCGCC
TGCTACTCCATGCTCTACTTGGTGATTTACCTACATCGTAGAATGCAATG
GAAGCAGTTGAGAATGCTGTGCCACCTGCTTCAGTTCCTGCTGCTCATGT
TCGCCTGGTATACGGCTCTCACCAGAGTTTCCGACTACAAGCACCATTGG
TCCGATGTCTTGGCAGGATCTGGCATCGGACTGACCTACGCAGTCGTCGT
GACATCGACTATGTGGGCAAGCTTTCTAGACCAT

BO30156.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:35:56
Subject Length Description Subject Range Query Range Score Percent Strand
wun2-RA 1053 CG8805-PA 1..1050 17..1066 5235 99.9 Plus
wun2-RB 741 CG8805-PB 1..738 329..1066 3675 99.9 Plus
wun-RC 1095 CG8804-PC 890..995 915..1020 200 79.2 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:35:57
Subject Length Description Subject Range Query Range Score Percent Strand
wun2-RA 1968 CG8805-RA 720..1769 17..1066 5235 99.9 Plus
wun2-RB 2211 CG8805-RB 1263..2012 317..1066 3735 99.9 Plus
wun2-RB 2211 CG8805-RB 720..1020 17..317 1505 100 Plus
wun-RC 1563 CG8804-RC 1272..1377 915..1020 200 79.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 06:35:54
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 9415061..9415361 17..317 1505 100 Plus
2R 25286936 2R 9416857..9417082 469..694 1115 99.6 Plus
2R 25286936 2R 9417156..9417335 695..874 900 100 Plus
2R 25286936 2R 9417394..9417571 874..1051 890 100 Plus
2R 25286936 2R 9416644..9416796 317..469 765 100 Plus
2R 25286936 2R 9402440..9402545 1020..915 200 79.2 Minus
Blast to na_te.dros performed on 2014-11-27 06:35:55 has no hits.

BO30156.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-12 10:52:52 Download gff for BO30156.complete
Subject Subject Range Query Range Percent Splice Strand
wun2-RA 718..1767 17..1068 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:47:50 Download gff for BO30156.complete
Subject Subject Range Query Range Percent Splice Strand
wun2-RA 720..1769 17..1068 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:49:17 Download gff for BO30156.complete
Subject Subject Range Query Range Percent Splice Strand
wun2-RA 720..1769 17..1068 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 07:49:17 Download gff for BO30156.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9417395..9417571 875..1051 100 -> Plus
2R 9417156..9417335 695..874 100 -> Plus
2R 9416858..9417082 470..694 99 -> Plus
2R 9416645..9416796 318..469 100 -> Plus
2R 9415061..9415361 17..317 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:47:50 Download gff for BO30156.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 5304900..5305076 875..1051 100 -> Plus
arm_2R 5304661..5304840 695..874 100 -> Plus
arm_2R 5304363..5304587 470..694 99 -> Plus
arm_2R 5304150..5304301 318..469 100 -> Plus
arm_2R 5302566..5302866 17..317 100 -> Plus

BO30156.pep Sequence

Translation from 16 to 1084

> BO30156.pep
MSTLRPVSVCDTTPLQRFESQSSSGEEPSSPTASSIIAAASGPNHNNNNN
VKLDLQLPTFVDSTRSQGSLYAVASNKKPPLRGPRQIFGRILTDLCLLSC
VGLPMLGFSLWGEAVKRGFFCDDSSLRHPYRDSTMPSWILYLMCGALPLT
VMLVVEFFRGQDKRLHSPFPKSTMCSGYHLCHLELPTWLVECYHRMGIFI
FGLGVEQLSTNIAKYSIGRLRPHFYTLCQPVMKDGTTCSDPINAARYIEE
FTCAAVDITSKQLKDMRLSFPSGHASFACYSMLYLVIYLHRRMQWKQLRM
LCHLLQFLLLMFAWYTALTRVSDYKHHWSDVLAGSGIGLTYAVVVTSTMW
ASFLDH

BO30156.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:10:16
Subject Length Description Subject Range Query Range Score Percent Strand
wun2-PA 350 CG8805-PA 1..350 1..350 1876 100 Plus
wun2-PB 246 CG8805-PB 1..246 105..350 1343 100 Plus
wun-PC 364 CG8804-PC 13..343 8..346 799 45.7 Plus
wun-PB 379 CG8804-PB 13..344 8..347 799 45.6 Plus
wun-PA 300 CG8804-PA 5..265 85..347 755 52.9 Plus