Clone BO30158 Report

Search the DGRC for BO30158

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:301
Well:58
Vector:pDNR-Dual
Associated Gene/TranscriptCRMP-RC
Protein status:BO30158.pep: Imported from assembly
Sequenced Size:904

Clone Sequence Records

BO30158.complete Sequence

904 bp assembled on 2011-09-12

GenBank Submission: KX799773

> BO30158.complete
GAAGTTATCAGTCGACATGTCGACCAGCCCGAAACCGGTTAAGAAGGTGC
CGATTCACTTGCAGAGTGCCCAGAATCGCGTCTACATCAAGAATGGCGAG
ATCGTCAACCATGACAAGTCCTTCAAAGCGGACGTGTACATCGAAGATGG
AATTATCAAGTTTGTGGGTCCCTCCTCGGAAATAACGATACCTGGCGGAG
TGCGCACCATCGACGCCAGCGGACTGATGATCATTCCCGGAGGCATCGAT
CCCCACACCCACATGCAGTTGCCTTTCGGCGGAGCCGTGGCCGTCGACGA
TTTCTACCATGGAACCAAGGCCGCCGTGGCAGGTGGCACCACCATGATCA
TCGACTTCGTTCTGCCCAACAAACATGAGTCGATGATCGAGGCCTACGAC
AAGTGGCGCAGCTGGGCCGATCCTAAGGTATGCTGCGACTACGGATTGCA
TGTGGGCATCACCTGGTGGTCGAAGTCGGTGTCTGAGGAGATCGGCATTC
TGTGCAAAGAGCTTGGAGTGAACTCCTTCAAAACATTCATGGCCTACAAA
GGACTTTATCAGTTGAATGACTCAGACCTTCTGGATGTGTTCGAGCGTAT
CAGGCACCTAAATGGGGTTGCTATGGTCCACGCGGAGAATGGCGACATCA
TTGCAAAGAACACGCAGCGCCTTTTGGCCGAGGGCATCAATGGTCCGGAG
GGTCACGAGCTGTCGCGGCCCGAGGAGGTCGAGGCCGAGGCGGTGCACCG
CGCCTGCGTCCTGGCCCACCAGGTAAGACCACTCCCATGTCGCCAGACAG
TGGGGGATGGATGGGAAGAGGGAGGAAGGAGGAGGCGGAGTGTGTCCATG
CCGGTTGAGTGCCATTGTGCACTGTGCCGCGCACTGGCAAGCTTTCTAGA
CCAT

BO30158.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:21:35
Subject Length Description Subject Range Query Range Score Percent Strand
CRMP-RE 1785 CG1411-PE 1..757 17..773 3785 100 Plus
CRMP-RB 999 CG1411-PB 1..757 17..773 3785 100 Plus
CRMP-RA 1770 CG1411-PA 1..756 17..772 3780 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:21:36
Subject Length Description Subject Range Query Range Score Percent Strand
CRMP-RE 2590 CG1411-RE 133..890 16..773 3790 100 Plus
CRMP-RB 2814 CG1411-RB 133..890 16..773 3790 100 Plus
CRMP-RA 2575 CG1411-RA 133..889 16..772 3785 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:21:33
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 5575778..5576039 625..886 1310 100 Plus
3R 32079331 3R 5574663..5574853 160..350 955 100 Plus
3R 32079331 3R 5575239..5575375 426..562 685 100 Plus
3R 32079331 3R 5574261..5574341 16..96 405 100 Plus
3R 32079331 3R 5574913..5574991 351..429 395 100 Plus
3R 32079331 3R 5574402..5574468 95..161 335 100 Plus
3R 32079331 3R 5575434..5575500 561..627 335 100 Plus
Blast to na_te.dros performed on 2014-11-27 07:21:34 has no hits.

BO30158.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-12 10:52:49 Download gff for BO30158.complete
Subject Subject Range Query Range Percent Splice Strand
CRMP-RC 134..1003 17..888 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:13:01 Download gff for BO30158.complete
Subject Subject Range Query Range Percent Splice Strand
CRMP-RB 134..894 17..778 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:09:00 Download gff for BO30158.complete
Subject Subject Range Query Range Percent Splice Strand
CRMP-RB 134..894 17..778 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:09:00 Download gff for BO30158.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5575779..5576039 626..888 99   Plus
3R 5575436..5575498 563..625 100 -> Plus
3R 5575241..5575375 428..562 100 -> Plus
3R 5574913..5574989 351..427 100 -> Plus
3R 5574663..5574853 160..350 100 -> Plus
3R 5574403..5574466 96..159 100 -> Plus
3R 5574262..5574340 17..95 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:13:01 Download gff for BO30158.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 1401501..1401761 626..888 99   Plus
arm_3R 1401158..1401220 563..625 100 -> Plus
arm_3R 1400963..1401097 428..562 100 -> Plus
arm_3R 1400635..1400711 351..427 100 -> Plus
arm_3R 1400385..1400575 160..350 100 -> Plus
arm_3R 1400125..1400188 96..159 100 -> Plus
arm_3R 1399984..1400062 17..95 100 -> Plus

BO30158.pep Sequence

Translation from 16 to 904

> BO30158.pep
MSTSPKPVKKVPIHLQSAQNRVYIKNGEIVNHDKSFKADVYIEDGIIKFV
GPSSEITIPGGVRTIDASGLMIIPGGIDPHTHMQLPFGGAVAVDDFYHGT
KAAVAGGTTMIIDFVLPNKHESMIEAYDKWRSWADPKVCCDYGLHVGITW
WSKSVSEEIGILCKELGVNSFKTFMAYKGLYQLNDSDLLDVFERIRHLNG
VAMVHAENGDIIAKNTQRLLAEGINGPEGHELSRPEEVEAEAVHRACVLA
HQVRPLPCRQTVGDGWEEGGRRRRSVSMPVECHCALCRALASFLDH

BO30158.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:10:04
Subject Length Description Subject Range Query Range Score Percent Strand
CRMP-PA 589 CG1411-PA 1..290 1..294 1343 89.9 Plus
CRMP-PB 332 CG1411-PB 1..252 1..252 1337 100 Plus
CRMP-PE 594 CG1411-PE 1..252 1..252 1337 100 Plus