Clone BO30167 Report

Search the DGRC for BO30167

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:301
Well:67
Vector:pDNR-Dual
Associated Gene/Transcriptdpr4-RB
Protein status:BO30167.pep: Imported from assembly
Sequenced Size:1003

Clone Sequence Records

BO30167.complete Sequence

1003 bp assembled on 2011-09-12

GenBank Submission: KX797256

> BO30167.complete
GAAGTTATCAGTCGACATGTGGACAACGGACTGCCCGAGAGCGTTGAAAG
CGATTTGCTTGGTGCCGCTGTGGCTGCTCCTCTTCCTCGATTGCGGCATG
GTCGGTGGCGAGGTGCCGCCGCATTACTGGGAAACCCCGTACTCGCAGCC
GTACTTCGACAACTCCTCGAGGCGTGAGGTCACCGCAACCGTCGGCCAGG
CGGCCCTGCTGCACTGCCGCGTCCGGAATCTGGGCGATCGAGCGGTGTCC
TGGATAAGGAAGCGCGACCTGCACATCCTGACGGTGGGAATACTAACGTA
CACAAACGACCAGCGCTTCCAGTCGCTGCACTCCGAGGGATCCGACGAGT
GGACGCTGCGCATCTCATCGCCGCAGCCGCGGGATTCGGGCACCTACGAG
TGCCAGGTGTCCACGGAGCCGAAGATCAGCCAAGGATTTCGCCTCAACGT
TGTGGTGTCACGGGCCAAGATCCTGGGCAACGCGGAGCTCTTCATCAAGA
GCGGCAGCGACATCAATCTCACCTGCCTGGCGATGCAGTCGCCGGTGCCG
CCATCGTTCATCTACTGGTACAAGGGCAAGCGGGTCATGAATTACTCGCA
GCGCGGTGGCATCAACGTCATCACGGAGCGTTCCACACGGACCAGCAAGC
TGCTCATAGCCAAGGCCACGCCGGCGGATTCGGGCAACTACACGTGCTCC
CCGAGCAGCTCAGATTCTGCCTCCGTGGTGGTGCACGTCATCAACGGGGA
ACATCCGGCCGCCATGCAGCACGGCAACAGCAGCGCCACCTGCCTGCGCC
CCCTTTCATCCACGTCCGTGCCTTTCGTCCTTGCCACCTGGATGTCGATG
ACGGTGGCGTCTGTCGCCTGGAACTCTAACCTCAACATCAACTGGAACTG
GAGCCCCGACTGGCGCTGGCACTGGAACCCTAAATGGAATTGGAGCAACC
TGGCCGCCGGTCTAGTGGGCATCTGGAGCTGGAGCGCAAGCTTTCTAGAC
CAT

BO30167.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:36:35
Subject Length Description Subject Range Query Range Score Percent Strand
dpr4-RB 972 CG33512-PB 1..969 17..985 4845 100 Plus
dpr5-RB 897 CG5308-PB 217..531 212..526 330 73.7 Plus
dpr5-RA 1011 CG5308-PA 331..645 212..526 330 73.7 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:36:36
Subject Length Description Subject Range Query Range Score Percent Strand
dpr4-RB 2994 CG33512-RB 1004..1974 15..985 4855 100 Plus
dpr5-RB 1419 CG5308-RB 302..616 212..526 330 73.7 Plus
dpr5-RA 1817 CG5308-RA 700..1014 212..526 330 73.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 06:36:33
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 11534503..11534777 985..711 1375 100 Minus
3R 32079331 3R 11535583..11535841 713..455 1295 100 Minus
3R 32079331 3R 11535969..11536180 455..244 1060 100 Minus
3R 32079331 3R 11539099..11539256 246..89 790 100 Minus
3R 32079331 3R 11539907..11539981 89..15 375 100 Minus
3R 32079331 3R 11503537..11503754 212..429 310 76.1 Plus
Blast to na_te.dros performed on 2014-11-27 06:36:34 has no hits.

BO30167.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-12 10:52:54 Download gff for BO30167.complete
Subject Subject Range Query Range Percent Splice Strand
dpr4-RB 1006..1974 17..987 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:48:12 Download gff for BO30167.complete
Subject Subject Range Query Range Percent Splice Strand
dpr4-RB 1006..1974 17..987 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:49:33 Download gff for BO30167.complete
Subject Subject Range Query Range Percent Splice Strand
dpr4-RB 1006..1974 17..987 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 07:49:33 Download gff for BO30167.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11539907..11539979 17..89 100   Minus
3R 11539101..11539255 90..244 100 <- Minus
3R 11535969..11536179 245..455 100 <- Minus
3R 11535583..11535840 456..713 100 <- Minus
3R 11534500..11534774 714..987 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:48:12 Download gff for BO30167.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 7365629..7365701 17..89 100   Minus
arm_3R 7364823..7364977 90..244 100 <- Minus
arm_3R 7361691..7361901 245..455 100 <- Minus
arm_3R 7361305..7361562 456..713 100 <- Minus
arm_3R 7360222..7360496 714..987 99 <- Minus

BO30167.pep Sequence

Translation from 16 to 1003

> BO30167.pep
MWTTDCPRALKAICLVPLWLLLFLDCGMVGGEVPPHYWETPYSQPYFDNS
SRREVTATVGQAALLHCRVRNLGDRAVSWIRKRDLHILTVGILTYTNDQR
FQSLHSEGSDEWTLRISSPQPRDSGTYECQVSTEPKISQGFRLNVVVSRA
KILGNAELFIKSGSDINLTCLAMQSPVPPSFIYWYKGKRVMNYSQRGGIN
VITERSTRTSKLLIAKATPADSGNYTCSPSSSDSASVVVHVINGEHPAAM
QHGNSSATCLRPLSSTSVPFVLATWMSMTVASVAWNSNLNINWNWSPDWR
WHWNPKWNWSNLAAGLVGIWSWSASFLDH

BO30167.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:10:23
Subject Length Description Subject Range Query Range Score Percent Strand
dpr4-PB 323 CG33512-PB 1..323 1..323 1758 100 Plus
dpr5-PB 298 CG5308-PB 52..286 45..279 670 56.2 Plus
dpr5-PA 336 CG5308-PA 90..324 45..279 670 56.2 Plus
dpr6-PC 390 CG14162-PC 65..285 37..255 631 56.1 Plus
dpr6-PF 396 CG14162-PF 65..291 37..255 614 54.6 Plus