Clone BO30171 Report

Search the DGRC for BO30171

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:301
Well:71
Vector:pDNR-Dual
Associated Gene/TranscriptCG4404-RA
Protein status:BO30171.pep: Imported from assembly
Sequenced Size:958

Clone Sequence Records

BO30171.complete Sequence

958 bp assembled on 2011-09-12

GenBank Submission: KX793829

> BO30171.complete
GAAGTTATCAGTCGACATGTGCTGGGTCGCAATGGCGCGCAAGGACGATC
CCGTTTTCAATGTGCGGTTCGTGCAGTTCGTGGAGAATCAGCCGTGCCTG
TGGAACTACACGCATCCGGGCTACAGCAAGAAGGAGGATGTGCAGAGGGC
GTGGCAGCAGGTTGCCAACGATATCAAGGACACGGTTCGCAACTGTCGCG
AGCGATGGCGCACCATAAGGAGCAGCTTCCTGCGATCCCTGAAGCTGGCA
CGCACACAAACGGGACGCGGCAAGCGCAAATACTACCTATCGAAGTATCT
TCAGTTTCTCGTTCCGTTCACCAAGTCGCGATCCTGCCACAAGCAGCTGC
CGGGCATGGTGCTCCGCAAACCCGGCCAAGCTGCCACTGCTCAGCAGGAA
GATGAGGTGGTGGCGGCGGAGGAGGAGGCCAAGGTGAGCGATGGTGAGAT
GCCGCTGGACGTTCAGGTGTCCGAGGAGGAGCATCGTCGTAATCAGGAAC
AGGATCGGGAGCAACCCACCGCCTGTTTGCCGCTCCGCCTGCATTCCATC
AAAGTGGAGCACGATTCGTCAAATGCGAACCAGCAGCTGGAGCGGATGGT
GAGCCAGCAGTCGCTGGTCTCGGTGCCCGCCGCCGCGCTGGGCAATCACC
TGGGCTGGTCGGATCTGACGCAGTGGTTCAAGGGACATGGCAGCGGTCAT
CACAAGTTAACCACAACAACAACAACACCAACATCACCACCACCGCCGCC
GCAGCCGGCTACGTCAGCTCTAAGTGTTTTCACTGGCGGACCAGGAGGAG
GTGGCTCACAACCGGATGCCGACTACTCCTTTCTGATCAGCCTGCATCCG
TACATCAAGGAGATGAACGGCAAGCAGAATCGAAAGTTTCGACAGAAGGT
CGTCGGACTCATCGACGATATTCTGGATAACAAGGATGTCGCAAGCTTTC
TAGACCAT

BO30171.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:36:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG4404-RA 927 CG4404-PA 1..924 17..940 4620 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:36:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG4404-RA 1696 CG4404-RA 237..1161 16..940 4625 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 06:36:10
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 12904280..12905035 940..185 3780 100 Minus
X 23542271 X 12905613..12905782 185..16 850 100 Minus
Blast to na_te.dros performed 2014-11-27 06:36:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Het-A 6610 Dvir\Het-A HETAVIR 6610bp 3548..3624 663..738 131 67.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2369..2421 690..744 116 72.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1521..1575 714..768 112 71.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2367..2418 691..744 111 74.5 Plus

BO30171.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-12 10:52:53 Download gff for BO30171.complete
Subject Subject Range Query Range Percent Splice Strand
CG4404-RA 255..1178 17..942 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:48:02 Download gff for BO30171.complete
Subject Subject Range Query Range Percent Splice Strand
CG4404-RA 238..1161 17..942 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:49:23 Download gff for BO30171.complete
Subject Subject Range Query Range Percent Splice Strand
CG4404-RA 238..1161 17..942 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 07:49:23 Download gff for BO30171.complete
Subject Subject Range Query Range Percent Splice Strand
X 12905613..12905781 17..185 100   Minus
X 12904278..12905034 186..942 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:48:02 Download gff for BO30171.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 12799646..12799814 17..185 100   Minus
arm_X 12798311..12799067 186..942 99 <- Minus

BO30171.pep Sequence

Translation from 16 to 958

> BO30171.pep
MCWVAMARKDDPVFNVRFVQFVENQPCLWNYTHPGYSKKEDVQRAWQQVA
NDIKDTVRNCRERWRTIRSSFLRSLKLARTQTGRGKRKYYLSKYLQFLVP
FTKSRSCHKQLPGMVLRKPGQAATAQQEDEVVAAEEEAKVSDGEMPLDVQ
VSEEEHRRNQEQDREQPTACLPLRLHSIKVEHDSSNANQQLERMVSQQSL
VSVPAAALGNHLGWSDLTQWFKGHGSGHHKLTTTTTTPTSPPPPPQPATS
ALSVFTGGPGGGGSQPDADYSFLISLHPYIKEMNGKQNRKFRQKVVGLID
DILDNKDVASFLDH

BO30171.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:10:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG4404-PA 308 CG4404-PA 1..308 1..308 1642 100 Plus
CG3838-PB 435 CG3838-PB 54..391 11..303 201 23.5 Plus
CG3838-PA 435 CG3838-PA 54..391 11..303 201 23.5 Plus
CG3919-PC 318 CG3919-PC 18..269 15..310 186 22.6 Plus
CG3919-PB 302 CG3919-PB 18..96 15..98 178 38.1 Plus