Clone BO30178 Report

Search the DGRC for BO30178

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:301
Well:78
Vector:pDNR-Dual
Associated Gene/TranscriptCG2974-RB
Protein status:BO30178.pep: Imported from assembly
Sequenced Size:859

Clone Sequence Records

BO30178.complete Sequence

859 bp assembled on 2011-09-12

GenBank Submission: KX800027

> BO30178.complete
GAAGTTATCAGTCGACATGAGCCTGATTTGCCGTCGATTTGGCTCTTCCT
TGAGGCCCATCGCCCGCACACTCCACCCACTGCTCGCCAGCAAAATCATC
GAAGCACAAAGGTCACCGCTGAAAAACAAGCGATTTTACGCCGGCAAGAG
AATGGATTTAAAGTATCTAAATCAAAAGGAGGCCATCGCCGTGGACCAGG
AACTATTCAACGATTACAAGTTCAGTGTGGATCAGCTAATGGAGCTGGCG
GGCTTGAGCTGCGCCCATGCTGTGGCCAAATGCTTCCCGGCAGAGAAGCA
TCCACGAATTCTCGTTTGCTGTGGACCAGGAAACAATGGAGGCGACGGCT
TGGTTGCCGCCCGCCACCTCGCCCTCATGGGCTACACACCCACCATCTAC
TATCCCAAGCCGACGGCCAAGCCGCTCTTCGAGAACCTCAGCCACCAGTG
CCAACAGATGGACATCTGCGACGTGAAGGAGTGTCCGTCGGTGGAGAGTG
CCGCCCGTGACTATGATCTCATTCTGGATGCGCTCTTCGGATTCAGCTTC
AAGCCGCCGGTGCGAGCGGACTTTGTCGCCGTCGTGGAACTAATGCAGCA
GACCAAACTGCCAATTGCCAGCGTGGACATTCCCAGCGGCTGGGATGTGG
AGAAGGGCAAGCTGACTGAATGCGACGTGGAGCCGGCTCTGCTCATTTCC
CTCACTGCGCCGAAACTCTGTGCCCGCCAATTTCGCGGCGAACATCACTA
CTTGGGCGGCAGATTCGTGCCGCCCGCCCTGCAGCGCAAATACGAACTGA
ATCTGCCCGTTTATCCGGGCAACGAGCTGTGCGTCAAGCTGGCAAGCTTT
CTAGACCAT

BO30178.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:07:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG2974-RB 693 CG2974-PB 1..690 152..841 3450 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:07:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG2974-RB 1200 CG2974-RB 107..931 17..841 4125 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:07:25
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 10085461..10086065 621..17 3025 100 Minus
X 23542271 X 10085183..10085405 841..619 1115 100 Minus
Blast to na_te.dros performed on 2014-11-27 07:07:26 has no hits.

BO30178.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-12 10:52:34 Download gff for BO30178.complete
Subject Subject Range Query Range Percent Splice Strand
CG2974-RB 107..931 17..843 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:05:57 Download gff for BO30178.complete
Subject Subject Range Query Range Percent Splice Strand
CG2974-RB 107..931 17..843 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:03:32 Download gff for BO30178.complete
Subject Subject Range Query Range Percent Splice Strand
CG2974-RB 107..931 17..843 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:03:32 Download gff for BO30178.complete
Subject Subject Range Query Range Percent Splice Strand
X 10085461..10086065 17..621 100   Minus
X 10085180..10085402 622..843 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:05:57 Download gff for BO30178.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 9979494..9980098 17..621 100   Minus
arm_X 9979213..9979435 622..843 99 <- Minus

BO30178.pep Sequence

Translation from 16 to 859

> BO30178.pep
MSLICRRFGSSLRPIARTLHPLLASKIIEAQRSPLKNKRFYAGKRMDLKY
LNQKEAIAVDQELFNDYKFSVDQLMELAGLSCAHAVAKCFPAEKHPRILV
CCGPGNNGGDGLVAARHLALMGYTPTIYYPKPTAKPLFENLSHQCQQMDI
CDVKECPSVESAARDYDLILDALFGFSFKPPVRADFVAVVELMQQTKLPI
ASVDIPSGWDVEKGKLTECDVEPALLISLTAPKLCARQFRGEHHYLGGRF
VPPALQRKYELNLPVYPGNELCVKLASFLDH

BO30178.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:09:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG2974-PB 230 CG2974-PB 1..230 46..275 1230 100 Plus