Clone BO30179 Report

Search the DGRC for BO30179

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:301
Well:79
Vector:pDNR-Dual
Associated Gene/TranscriptCG7378-RA
Protein status:BO30179.pep: Imported from assembly
Sequenced Size:652

Clone Sequence Records

BO30179.complete Sequence

652 bp assembled on 2011-09-12

GenBank Submission: KX799575

> BO30179.complete
GAAGTTATCAGTCGACATGTCATGGAGATATGCGTCGCCCAGCCGCTTGG
AGACCTCCGAACAGACCACAGGCCGCCAGCTGCAGCGAGTCCTGCACTAC
TCGATGGCTCCTAGCCGGGCTCTTCCAGGACTAAGACGCGCCGAGTGCGC
CATCCATGACGTTGACTGTGATGAGGTCTATCCGGGCATCTACATTGGTG
ATGCTGCGGCGGCCAAAAACAAAACGTATCTGAGATTGATGGGCATCACC
CACGTTCTGAACGCGGCCGAGGGATGTCGGTATGGTCAGGTGGACACTGG
ACACAGCTACTACCGGGATATGCCCAGCATCAGGTACATGGGCTTCCCCA
TGGTCGATGCCCCAACGACAGACATCTCGCGCTACTTCTACGTGGCCTCC
AAGTTCATCGACAGCGCCATCAGCAGCGGCGGCAAGATCCTGGTCCACTG
CCTGGTGGGCATGTCGCGATCGGCCACCTGTGTGCTGGCCTACCTGATGA
TCTGCCGGAAGATGTCGGCGGTGGACGCGATACGCACGGTGCGGATGAGG
CGCGATATCCGGCCGAATGATGGATTCCTGCAGCAACTGGCCGACTTGGA
CATGGAGCTCAAGCGCAAGAACCTGTATCCCTACGCAAGCTTTCTAGACC
AT

BO30179.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:08:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG7378-RA 621 CG7378-PA 1..618 17..634 3090 100 Plus
CG7378-RB 681 CG7378-PB 78..678 34..634 3005 100 Plus
CG7378-RC 708 CG7378-PC 403..705 332..634 1515 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:08:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG7378-RA 1189 CG7378-RA 371..988 17..634 3090 100 Plus
CG7378-RB 2020 CG7378-RB 448..1048 34..634 3005 100 Plus
CG7378-RC 3832 CG7378-RC 773..1075 332..634 1515 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:08:20
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 18908883..18909086 431..634 1020 100 Plus
X 23542271 X 18907498..18907668 34..204 855 100 Plus
X 23542271 X 18907731..18907861 205..335 655 100 Plus
X 23542271 X 18908275..18908379 332..436 510 99 Plus
Blast to na_te.dros performed on 2014-11-27 07:08:21 has no hits.

BO30179.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-12 10:52:35 Download gff for BO30179.complete
Subject Subject Range Query Range Percent Splice Strand
CG7378-RA 371..988 17..636 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:06:31 Download gff for BO30179.complete
Subject Subject Range Query Range Percent Splice Strand
CG7378-RA 371..988 17..636 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:03:59 Download gff for BO30179.complete
Subject Subject Range Query Range Percent Splice Strand
CG7378-RA 371..988 17..636 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:03:59 Download gff for BO30179.complete
Subject Subject Range Query Range Percent Splice Strand
X 18908884..18909086 432..636 99   Plus
X 18908277..18908374 334..431 100 -> Plus
X 18907731..18907859 205..333 100 -> Plus
X 18907499..18907668 35..204 100 -> Plus
X 18900943..18900960 17..34 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:06:31 Download gff for BO30179.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 18802917..18803119 432..636 99   Plus
arm_X 18802310..18802407 334..431 100 -> Plus
arm_X 18801764..18801892 205..333 100 -> Plus
arm_X 18801532..18801701 35..204 100 -> Plus
arm_X 18794976..18794993 17..34 100 -> Plus

BO30179.pep Sequence

Translation from 16 to 652

> BO30179.pep
MSWRYASPSRLETSEQTTGRQLQRVLHYSMAPSRALPGLRRAECAIHDVD
CDEVYPGIYIGDAAAAKNKTYLRLMGITHVLNAAEGCRYGQVDTGHSYYR
DMPSIRYMGFPMVDAPTTDISRYFYVASKFIDSAISSGGKILVHCLVGMS
RSATCVLAYLMICRKMSAVDAIRTVRMRRDIRPNDGFLQQLADLDMELKR
KNLYPYASFLDH

BO30179.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:09:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG7378-PA 206 CG7378-PA 1..206 1..206 1080 100 Plus
CG7378-PB 226 CG7378-PB 25..226 5..206 1050 99.5 Plus
CG7378-PC 235 CG7378-PC 25..235 5..206 1030 95.3 Plus
Mkp3-PA 241 CG14080-PA 47..187 53..199 206 34.2 Plus
Mkp3-PD 411 CG14080-PD 217..357 53..199 206 34.2 Plus