Clone BO30180 Report

Search the DGRC for BO30180

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:301
Well:80
Vector:pDNR-Dual
Associated Gene/TranscriptCG11560-RA
Protein status:BO30180.pep: Imported from assembly
Sequenced Size:943

Clone Sequence Records

BO30180.complete Sequence

943 bp assembled on 2011-09-12

GenBank Submission: KX796054

> BO30180.complete
GAAGTTATCAGTCGACATGACCATAAGGATTGCGAGGCGAAATATGTTTT
TCATACACGCCCCCGAGGAGGAGAAGTGCATGGAGGCGCAGCTGGACATC
CTTATGAAGATCAACTCCGGTGAATATCGGCTGGTGAAGAAGAACAAGCG
CAGTTCCGTTTGGAACGTCTACCGGGAAATCGCTCGTCCGGACGGCACCA
AGTTGAAATGGCGATACTTCTGCATGGGCTGCAAGCGTGTGATGCAGAGC
ACCGGCGGCACCACCTCCAATCTGCGCATCCACAAGTGCCACGTACGGTA
TATCAAGCAGAACGGCCATCTCACCGACGGCAGTCACTCCTACGACCATG
ATCCCGCGCCACCAGCTAGCCAACCGTCGCCGCGCGTCCAGAAACCGAAG
ACCAGGCGGCCGACATCCTATTCTACGCAGTGTGAGCAGTTCTATGAGGT
CACCATGGATCCGGAGACCCAGTACAGCGATCTGGATGATGAGATTGAGG
CTTCTTTGGAGGAGGAGCAGACTCTGAAATCAAAACGTGAATTGGAATCC
TCCCACTCCAGACCCCTGCTGAAGCTCTTCTCCGAGGAGAACTTGTCGAC
TGAACCAGAGGAGCCGGAAGACGAGATTGAGATTGTGGAGGCGGAAGATC
AGGTGCCCATCGAGCTGGACCTATGTGACATCCAACATACTACATCCGAT
GCTGGCGGTGAGGCAATCGAACCCAAGCCAACGGAAAGTGTCGCCCAGTT
CGATGCCAATGCCATTTCCGAAGCGGAATCCTATGCCAAAGCCTGGGCTC
ACGCCTTCCTGCGGCTGAACGAGGACCAAAAGTTCTACGCCAAGCGCTCC
ATAGATGAACTACTGGTCTTGGGTCGTCTGGAGCGACTGAGCATTTCCAC
GGTCACATCCTTGACCACAAACCTGGCAAGCTTTCTAGACCAT

BO30180.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:09:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG11560-RA 912 CG11560-PA 1..909 17..925 4545 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:09:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG11560-RA 1101 CG11560-RA 64..972 17..925 4545 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:09:08
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 12120082..12120588 17..523 2535 100 Plus
3L 28110227 3L 12120655..12121056 524..925 2010 100 Plus
Blast to na_te.dros performed on 2014-11-27 07:09:09 has no hits.

BO30180.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-12 10:52:36 Download gff for BO30180.complete
Subject Subject Range Query Range Percent Splice Strand
CG11560-RA 20..928 17..927 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:06:58 Download gff for BO30180.complete
Subject Subject Range Query Range Percent Splice Strand
CG11560-RA 64..972 17..927 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:04:19 Download gff for BO30180.complete
Subject Subject Range Query Range Percent Splice Strand
CG11560-RA 64..972 17..927 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:04:19 Download gff for BO30180.complete
Subject Subject Range Query Range Percent Splice Strand
3L 12120655..12121056 524..927 99   Plus
3L 12120082..12120588 17..523 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:06:58 Download gff for BO30180.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 12113755..12114156 524..927 99   Plus
arm_3L 12113182..12113688 17..523 100 -> Plus

BO30180.pep Sequence

Translation from 16 to 943

> BO30180.pep
MTIRIARRNMFFIHAPEEEKCMEAQLDILMKINSGEYRLVKKNKRSSVWN
VYREIARPDGTKLKWRYFCMGCKRVMQSTGGTTSNLRIHKCHVRYIKQNG
HLTDGSHSYDHDPAPPASQPSPRVQKPKTRRPTSYSTQCEQFYEVTMDPE
TQYSDLDDEIEASLEEEQTLKSKRELESSHSRPLLKLFSEENLSTEPEEP
EDEIEIVEAEDQVPIELDLCDIQHTTSDAGGEAIEPKPTESVAQFDANAI
SEAESYAKAWAHAFLRLNEDQKFYAKRSIDELLVLGRLERLSISTVTSLT
TNLASFLDH

BO30180.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:09:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG11560-PA 303 CG11560-PA 1..303 1..303 1581 100 Plus
ssp-PA 368 CG17153-PA 14..86 23..97 210 54.7 Plus
CG34116-PA 211 CG34116-PA 7..123 27..122 184 36.8 Plus
CG34116-PA 211 CG34116-PA 99..207 195..296 162 33.9 Plus