Clone BO30181 Report

Search the DGRC for BO30181

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:301
Well:81
Vector:pDNR-Dual
Associated Gene/TranscriptCyp4d14-RA
Protein status:BO30181.pep: Imported from assembly
Sequenced Size:1555

Clone Sequence Records

BO30181.complete Sequence

1555 bp assembled on 2011-09-12

GenBank Submission: KX795666

> BO30181.complete
GAAGTTATCAGTCGACATGTATCTAGAGCTCTTTGCGATTCTCCTGGCGA
CCGCTTTGGCGTGGGATTATATGCGAAAGAGGCGGCACAACAAGATGTAC
GCCGAGGCTGGGATACGAGGACCCAAGAGCTATCCTCTGGTTGGAAACGC
TCCCTTGTTGATTAACGAGTCACCCAAGACTATCTTTGATATGCAGTTCC
GACTGATTGCTGAGTTTGGTAAAAACATAAAAACGCAGATGTTGGGCGAA
AGTGGCTTCATGACCGCTGATTCCAAAATGATCGAGGCGATCATGAGCAG
CCAACAGACCATTCAAAAAAACAATCTTTATAGTCTGCTGGTAAATTGGC
TCGGCGATGGACTGCTCATTAGCCAAGGAAAGAAGTGGTTCCGCCGCAGG
AAGATCATTACACCCGCATTCCACTTTAAGATCCTCGAGGACTTTGTGGA
GGTCTTTGACCAACAGAGCGCAACTATGGTCCAGAAGCTTTACGATCGGG
CAGACGGCAAGACGGTGATAAACATGTTCCCGGTGGCTTGCTTGTGTGCC
ATGGATATCATTGCGGAAACGGCCATGGGTGTAAAAATTAATGCTCAGCT
CCAGCCGCAATTTACCTACGTTCAGTCGGTCACAACTGCCTCTGCAATGT
TAGCCGAACGCTTCATGAATCCCTTGCAGCGCTTGGATTTCACCATGAAG
CTCTTCTATCCCAAATTGCTAGACAAGCTGAATGATGCCGTGAAGAACAT
GCACGACTTTACCAACTCGGTAATCACTGAGCGACGCGAGCTCCTACAAA
AAGCCATTGCCGATGGAGGAGATGCCGACGCTGCCCTCTTGAACGATGTG
GGCCAGAAGCGTCGTATGGCTCTTCTTGATGTGCTGCTGAAGTCCACCAT
CGATGGGGCTCCGTTGAGCAACGACGACATCCGCGAGGAGGTAGACACCT
TCATGTTCGAGGGTCATGACACTACGACCAGTAGCATTGCTTTTACCTGT
TATTTGCTGGCTCGACATCCTGAGGTTCAGGCTCGCGTCTTCCAGGAGGT
CAGAGATGTTATCGGTGATGACAAGTCGGCTCCAGTTACTATGAAGCTAC
TCGGCGAGCTCAAGTACTTAGAGTGCGTGATAAAGGAGTCTCTGCGCCTG
TTTCCCTCGGTGCCGATCATTGGACGCTACATTTCCCAGGACACCGTACT
CGACGGCAAATTGATACCCGCCGACTCGAATGTGATCATTCTTATTTACC
ATGCTCAGCGCGATCCAGACTACTTCCCTGATCCGGAGAAGTTCATCCCT
GATCGTTTCAGCATGGAGCGCAAGGGCGAGATCAGTCCATTCGCCTATAC
TCCCTTCTCAGCGGGTCCGAGAAACTGCATCGGCCAAAAGTTCGCAATGC
TCGAGATGAAGAGCACCATCAGCAAAATGGTGAGACACTTTGAGTTGCTG
CCTCTGGGCGAAGAAGTCCAGCCCGTACTGAACGTTATCCTGCGCTCGAC
CACCGGAATCAATTGTGGCCTCAAGCCGCGCGTCTATGCAAGCTTTCTAG
ACCAT

BO30181.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:08:49
Subject Length Description Subject Range Query Range Score Percent Strand
Cyp4d14-RA 1524 CG3540-PA 1..1521 17..1537 7605 100 Plus
Cyp4d14-RB 1533 CG3540-PB 1..1530 17..1537 7480 99.4 Plus
Cyp4d2-RB 1506 CG3466-PB 821..951 849..979 355 84.7 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:08:50
Subject Length Description Subject Range Query Range Score Percent Strand
Cyp4d14-RA 1685 CG3540-RA 78..1600 15..1537 7615 100 Plus
Cyp4d14-RB 1694 CG3540-RB 78..1609 15..1537 7490 99.4 Plus
Cyp4d2-RB 2467 CG3466-RB 1722..1852 849..979 355 84.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:08:47
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 2173500..2174400 1537..637 4505 100 Minus
X 23542271 X 2174464..2174920 636..180 2285 100 Minus
X 23542271 X 2175074..2175238 179..15 825 100 Minus
X 23542271 X 2177927..2178057 849..979 355 84.7 Plus
3L 28110227 3L 7494248..7494385 982..845 225 77.5 Minus
X 23542271 X 2178482..2178583 1351..1452 210 80.4 Plus
Blast to na_te.dros performed on 2014-11-27 07:08:48 has no hits.

BO30181.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-12 18:11:31 Download gff for BO30181.complete
Subject Subject Range Query Range Percent Splice Strand
Cyp4d14-RA 78..1598 17..1539 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:06:47 Download gff for BO30181.complete
Subject Subject Range Query Range Percent Splice Strand
Cyp4d14-RA 80..1600 17..1539 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:04:10 Download gff for BO30181.complete
Subject Subject Range Query Range Percent Splice Strand
Cyp4d14-RA 80..1600 17..1539 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:04:10 Download gff for BO30181.complete
Subject Subject Range Query Range Percent Splice Strand
X 2175074..2175236 17..179 100   Minus
X 2174464..2174920 180..636 100 <- Minus
X 2173498..2174400 637..1539 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:06:47 Download gff for BO30181.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 2069107..2069269 17..179 100   Minus
arm_X 2068497..2068953 180..636 100 <- Minus
arm_X 2067531..2068433 637..1539 99 <- Minus

BO30181.pep Sequence

Translation from 16 to 1555

> BO30181.pep
MYLELFAILLATALAWDYMRKRRHNKMYAEAGIRGPKSYPLVGNAPLLIN
ESPKTIFDMQFRLIAEFGKNIKTQMLGESGFMTADSKMIEAIMSSQQTIQ
KNNLYSLLVNWLGDGLLISQGKKWFRRRKIITPAFHFKILEDFVEVFDQQ
SATMVQKLYDRADGKTVINMFPVACLCAMDIIAETAMGVKINAQLQPQFT
YVQSVTTASAMLAERFMNPLQRLDFTMKLFYPKLLDKLNDAVKNMHDFTN
SVITERRELLQKAIADGGDADAALLNDVGQKRRMALLDVLLKSTIDGAPL
SNDDIREEVDTFMFEGHDTTTSSIAFTCYLLARHPEVQARVFQEVRDVIG
DDKSAPVTMKLLGELKYLECVIKESLRLFPSVPIIGRYISQDTVLDGKLI
PADSNVIILIYHAQRDPDYFPDPEKFIPDRFSMERKGEISPFAYTPFSAG
PRNCIGQKFAMLEMKSTISKMVRHFELLPLGEEVQPVLNVILRSTTGINC
GLKPRVYASFLDH

BO30181.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:14:43
Subject Length Description Subject Range Query Range Score Percent Strand
Cyp4d14-PA 507 CG3540-PA 1..507 1..507 2599 100 Plus
Cyp4d14-PB 510 CG3540-PB 1..510 1..507 2581 99.2 Plus
Cyp4d2-PB 501 CG3466-PB 8..500 5..505 1364 54.3 Plus
Cyp4d2-PA 501 CG3466-PA 8..500 5..505 1364 54.3 Plus
Cyp4d20-PA 510 CG16761-PA 1..506 1..505 1186 46.6 Plus