Clone BO30182 Report

Search the DGRC for BO30182

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:301
Well:82
Vector:pDNR-Dual
Associated Gene/TranscriptCyp6a19-RA
Protein status:BO30182.pep: Imported from assembly
Sequenced Size:1543

Clone Sequence Records

BO30182.complete Sequence

1543 bp assembled on 2011-09-12

GenBank Submission: KX796030

> BO30182.complete
GAAGTTATCAGTCGACATGGCGATCCTGCTCGGTTTGGTGGTCGGTGTCC
TTACGCTCGTCGCTTGGTGGGTGCTCCAGAACTACACCTACTGGAAACGG
CGAGGAATTCCCCATGATCCACCCAATATTCCGCTCGGCAATACCGGCGA
ACTTTGGAGAACAATGCCGCTGGCCGGCATCCTCAAGCGAACATATCTGA
AATTCAGGAAACAGACCGACGGACCTTTTGCGGGCTTCTACCTCTATGCT
ATGAAGTACATTGTCATCACGGACGTGGATTTTGTAAAAACCGTGCTAAT
TCGCGACTTCGATAAGTTTCACGATCGCGGAGTGTATCACAACGAAAAGG
ATGATCCGCTGACCAATAACCTGGCAACCATCGAGGGTCAAAAGTGGAAA
AATCTGCGACAGAAGCTGACCCACACATTTACGTCAGCCAAAATGAAGAG
CATGTTTTCCACGGTCTTAAACGTGGGCGATGAGATGATTCGCGTGGTCG
ATGAAAAGATCTCCAGTTCTTCGCAGACCCTGGAAGTCACCGACATTGTG
TCACGCTTCACATCCGACGTAATTGGAATCTGTGCTTTTGGCCTGAAATG
CAATAGTCTGCGGGATCCTAAGGCGGAGTTCGTCCAAATGGGCTACTCAG
CGCTAAGAGAACGTCGTCATGGTTGGCTGGTAGATCTACTAATCTTCGGG
ATGCCTAAACTGGCCGTGAAACTGGGTTTCCAGTTCTTGCTTCCCTCGGT
GCAGAAGTTCTATATGAAAATCGTGCAGGACACCATAGATTACAGGATGA
AGAGAAAGGTGACTCGGAACGATTTCATGGACACGTTGATTGACATGAAA
CAGCAGTATGATAAAGGCGACAAGGAAAATGGACTTGCCTTCAATGAGGT
CGCTGCCCAGGCCTTCGTATTTTTCCTAGCTGGTTTTGAGGCGGGATCCA
CAACCATGGGATTCACACTTTATGAGCTGGCCTGCAATCAGGATGTTCAG
GACAAGTTGAGGGCTGAAATCGACAGTGTGCTGGAAAGGTACAATGGTAA
ACTGGAATACGATTCTATGCAGGACTTGTTTTATATGGAAAAGGTTATCA
ATGAATCGCTAAGGAAACATCCAGTGGTAGCCCACTTGGCTCGCATTGCC
ACCAAACCGTACCAGCACAGTAATCCCAAGTATTTCATAGAGGCCGGCAC
TGGAGTGCTGGTGTCCACCCTGGGCATCCATCATGATCCTGAGTTTTATC
CGGAGCCGGAAAAGTTTATCCCAGAACGATTCGATGAAGAGCAAGTAAAG
AAGCGTCCCACCTGCGCTTTCCTACCCTTCGGAGCTGGTCCCCGAAATTG
CATTGGACTCCGATTCGGACGGATGCAGGTCATCATTGGATTGGCCCTGC
TAATCCACAATTTTAGGTTCGAATTGCATCCCAAGACGCCAGTGCCAATG
AAATACACAATCAATAACCTTTTGCTGGGCTCCGAGGGCGGAATCCATCT
CAATATCACCAAGGTAGTGAGAGACGCAAGCTTTCTAGACCAT

BO30182.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:09:24
Subject Length Description Subject Range Query Range Score Percent Strand
Cyp6a19-RA 1512 CG10243-PA 1..1509 17..1525 7545 100 Plus
Cyp6a19-RB 1104 CG10243-PB 1..1087 17..1103 5435 100 Plus
Cyp6a20-RB 1505 CG10245-PB 802..1416 819..1433 735 74.6 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:09:25
Subject Length Description Subject Range Query Range Score Percent Strand
Cyp6a19-RA 1694 CG10243-RA 15..1523 17..1525 7545 100 Plus
Cyp6a19-RB 1903 CG10243-RB 15..1513 17..1525 7360 99.3 Plus
Cyp6a20-RB 1801 CG10245-RB 816..1430 819..1433 735 74.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:09:22
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 14877800..14878886 17..1103 5435 100 Plus
2R 25286936 2R 14878940..14879362 1103..1525 2115 100 Plus
2R 25286936 2R 14883402..14883675 1160..1433 425 77 Plus
2R 25286936 2R 14882933..14883116 819..1002 395 81 Plus
2R 25286936 2R 14882404..14882597 290..483 310 77.3 Plus
2R 25286936 2R 14874868..14874962 908..1002 220 82.1 Plus
2R 25286936 2R 14874336..14874414 379..457 185 82.3 Plus
Blast to na_te.dros performed on 2014-11-27 07:09:23 has no hits.

BO30182.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-12 10:52:37 Download gff for BO30182.complete
Subject Subject Range Query Range Percent Splice Strand
Cyp6a19-RA 13..1521 17..1527 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:07:08 Download gff for BO30182.complete
Subject Subject Range Query Range Percent Splice Strand
Cyp6a19-RA 15..1523 17..1527 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:04:27 Download gff for BO30182.complete
Subject Subject Range Query Range Percent Splice Strand
Cyp6a19-RA 15..1523 17..1527 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:04:27 Download gff for BO30182.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14878941..14879362 1104..1527 99   Plus
2R 14877800..14878886 17..1103 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:07:08 Download gff for BO30182.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 10766446..10766867 1104..1527 99   Plus
arm_2R 10765305..10766391 17..1103 100 -> Plus

BO30182.pep Sequence

Translation from 16 to 1543

> BO30182.pep
MAILLGLVVGVLTLVAWWVLQNYTYWKRRGIPHDPPNIPLGNTGELWRTM
PLAGILKRTYLKFRKQTDGPFAGFYLYAMKYIVITDVDFVKTVLIRDFDK
FHDRGVYHNEKDDPLTNNLATIEGQKWKNLRQKLTHTFTSAKMKSMFSTV
LNVGDEMIRVVDEKISSSSQTLEVTDIVSRFTSDVIGICAFGLKCNSLRD
PKAEFVQMGYSALRERRHGWLVDLLIFGMPKLAVKLGFQFLLPSVQKFYM
KIVQDTIDYRMKRKVTRNDFMDTLIDMKQQYDKGDKENGLAFNEVAAQAF
VFFLAGFEAGSTTMGFTLYELACNQDVQDKLRAEIDSVLERYNGKLEYDS
MQDLFYMEKVINESLRKHPVVAHLARIATKPYQHSNPKYFIEAGTGVLVS
TLGIHHDPEFYPEPEKFIPERFDEEQVKKRPTCAFLPFGAGPRNCIGLRF
GRMQVIIGLALLIHNFRFELHPKTPVPMKYTINNLLLGSEGGIHLNITKV
VRDASFLDH

BO30182.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:09:20
Subject Length Description Subject Range Query Range Score Percent Strand
Cyp6a19-PA 503 CG10243-PA 1..503 1..503 2647 100 Plus
Cyp6a19-PB 367 CG10243-PB 1..366 1..366 1894 98.9 Plus
Cyp6a20-PB 501 CG10245-PB 1..501 1..500 1858 66.3 Plus
Cyp6a17-PB 501 CG10241-PB 2..501 3..502 1370 50.7 Plus
Cyp6a17-PA 501 CG10241-PA 2..501 3..502 1370 50.7 Plus