Clone BO30187 Report

Search the DGRC for BO30187

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:301
Well:87
Vector:pDNR-Dual
Associated Gene/TranscriptAct88F-RA
Protein status:BO30187.pep: Imported from assembly
Sequenced Size:1162

Clone Sequence Records

BO30187.complete Sequence

1162 bp assembled on 2011-09-12

GenBank Submission: KX794481

> BO30187.complete
GAAGTTATCAGTCGACATGTGTGACGATGATGCGGGTGCATTAGTTATCG
ACAACGGATCGGGCATGTGCAAAGCCGGCTTCGCCGGTGATGACGCTCCC
CGTGCTGTCTTCCCCTCAATTGTGGGTCGTCCCCGACACCAGGGTGTGAT
GGTGGGTATGGGTCAGAAGGACTCGTACGTGGGCGACGAGGCGCAAAGCA
AGCGCGGTATCCTGACGCTGAAGTACCCCATCGAGCACGGCATCATCACG
AACTGGGACGACATGGAGAAGATCTGGCATCACACCTTCTACAACGAGCT
GCGCGTGGCCCCCGAGGAGCATCCAGTATTATTGACCGAGGCTCCACTGA
ACCCCAAGGCCAATCGCGAGAAGATGACCCAGATCATGTTCGAGACCTTC
AACTCGCCGGCCATGTACGTGGCCATCCAGGCCGTGCTCTCCCTGTACGC
CTCCGGTCGTACCACCGGTATTGTGCTGGACTCCGGCGATGGTGTCTCCC
ACACCGTGCCCATCTATGAGGGCTTCGCCCTGCCCCACGCCATTCTGCGT
CTGGATCTGGCTGGTCGCGATCTGACCGATTACCTGATGAAGATCCTGAC
GGAGCGCGGCTACAGCTTCACCACCACCGCCGAGCGTGAGATCGTGCGCG
ACATCAAGGAGAAGCTGTGCTACGTGGCTCTGGACTTCGAGCAGGAGATG
GCCACCGCTGCCGCCTCCACCTCGCTGGAGAAGTCGTACGAGTTGCCTGA
CGGCCAGGTGATCACCATTGGCAACGAGCGCTTCCGCTGCCCCGAGGCTC
TGTTCCAGCCCTCGTTCCTGGGCATGGAGTCGTGCGGCATCCACGAGACC
GTCTACAACTCGATCATGAAGTGCGACGTGGACATCCGCAAGGATCTGTA
TGCCAACTCTGTGCTGTCCGGCGGTACCACCATGTACCCTGGTATTGCCG
ATCGTATGCAGAAGGAGATCACTGCCCTGGCCCCATCGACCATCAAGATC
AAGATCATTGCGCCACCCGAGAGGAAGTACTCCGTCTGGATCGGTGGCTC
CATCCTGGCCTCGCTGTCCACCTTCCAGCAGATGTGGATCTCGAAGCAGG
AGTACGACGAGTCCGGCCCCGGAATCGTTCACCGCAAATGCTTTGCAAGC
TTTCTAGACCAT

BO30187.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:09:13
Subject Length Description Subject Range Query Range Score Percent Strand
Act88F-RA 1131 CG5178-PA 1..1128 17..1144 5640 100 Plus
Act79B-RB 1131 CG7478-PB 34..1127 50..1143 3865 90.2 Plus
Act79B-RA 1131 CG7478-PA 34..1127 50..1143 3865 90.2 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:09:14
Subject Length Description Subject Range Query Range Score Percent Strand
Act88F-RA 1595 CG5178-RA 95..1222 17..1144 5640 100 Plus
Act79B-RB 1619 CG7478-RB 175..1268 50..1143 3865 90.2 Plus
Act79B-RA 1543 CG7478-RA 99..1192 50..1143 3865 90.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:09:12
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 15440616..15441543 17..944 4640 100 Plus
3R 32079331 3R 13426604..13427730 17..1143 3790 89.1 Plus
2R 25286936 2R 20944849..20945930 62..1143 3700 89.5 Plus
X 23542271 X 5902698..5903824 17..1143 3655 88.3 Plus
3L 28110227 3L 21985384..21986277 50..943 3225 90.7 Plus
2R 25286936 2R 6014274..6015400 1143..17 3100 85 Minus
3R 32079331 3R 15441601..15441804 941..1144 1020 100 Plus
3L 28110227 3L 21986637..21986839 941..1143 655 88.2 Plus
2R 25286936 2R 16774750..16774997 335..582 265 73.8 Plus
2R 25286936 2R 16775178..16775338 775..935 205 75.2 Plus
Blast to na_te.dros performed on 2014-11-27 07:09:13 has no hits.

BO30187.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-12 18:11:33 Download gff for BO30187.complete
Subject Subject Range Query Range Percent Splice Strand
Act88F-RA 76..1203 17..1146 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:07:00 Download gff for BO30187.complete
Subject Subject Range Query Range Percent Splice Strand
Act88F-RA 95..1222 17..1146 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:04:20 Download gff for BO30187.complete
Subject Subject Range Query Range Percent Splice Strand
Act88F-RA 95..1222 17..1146 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:04:20 Download gff for BO30187.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15441602..15441804 942..1146 99   Plus
3R 15440616..15441540 17..941 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:07:00 Download gff for BO30187.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 11267324..11267526 942..1146 99   Plus
arm_3R 11266338..11267262 17..941 100 -> Plus

BO30187.pep Sequence

Translation from 16 to 1162

> BO30187.pep
MCDDDAGALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQ
KDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPE
EHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTT
GIVLDSGDGVSHTVPIYEGFALPHAILRLDLAGRDLTDYLMKILTERGYS
FTTTAEREIVRDIKEKLCYVALDFEQEMATAAASTSLEKSYELPDGQVIT
IGNERFRCPEALFQPSFLGMESCGIHETVYNSIMKCDVDIRKDLYANSVL
SGGTTMYPGIADRMQKEITALAPSTIKIKIIAPPERKYSVWIGGSILASL
STFQQMWISKQEYDESGPGIVHRKCFASFLDH

BO30187.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:14:47
Subject Length Description Subject Range Query Range Score Percent Strand
Act88F-PA 376 CG5178-PA 1..376 1..376 1968 100 Plus
Act87E-PC 376 CG18290-PC 1..376 1..376 1936 97.6 Plus
Act87E-PB 376 CG18290-PB 1..376 1..376 1936 97.6 Plus
Act87E-PA 376 CG18290-PA 1..376 1..376 1936 97.6 Plus
Act57B-PA 376 CG10067-PA 1..376 1..376 1933 97.3 Plus