Clone BO30190 Report

Search the DGRC for BO30190

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:301
Well:90
Vector:pDNR-Dual
Associated Gene/TranscriptCG12945-RB
Protein status:BO30190.pep: Imported from assembly
Sequenced Size:1381

Clone Sequence Records

BO30190.complete Sequence

1381 bp assembled on 2011-09-12

GenBank Submission: KX800093

> BO30190.complete
GAAGTTATCAGTCGACATGAGAACGGAGGCAGCGGTCAGTTGTTTCCTGT
TGGTATTGCACAGGGTATGCTGTCAGAGCGGCAACGATGAGTCCTGGCTG
AGTCCGGATCCCGCCTGGTCGGACCTGGTTAACGATATCAATCAGCCCGG
TGAATTGTGCCAGTGTCCTACGTGTCCAGATGTGTCTCCAGTGGCCATGG
AGGATGCCGTGGCACTCACATACTTCAAGAAGTTCGTCAATCTGCTGTTC
CAGCGCAAGCGTTTTCAGTACGATGTTATGTCGGCGGTCCATAAGCGATC
GCTGCTCTTCTCCCTGATCCCATCGCAACTGGATGAACTGGAGAGGGTGC
AGGATGCTCGGGATTTGGACGTTTTGCTGACTAAGATATTGGAGAGTGCC
GAGGAGGCTCCTTTGTTTAATGGAAGATCCGGATGCTCATACGTCCGACA
CGGCTTTTTCTCCTTATTGGTGGATATTTTCAAGGATGTAATTGAACTGA
CGCAAACGACCGAGGTGAAATTTATCCTATATGCAACATTAGCAATTGCA
CTTGTCGTCATTGTGCACAAACGTTTCCGTGTCGGACTAATTTCAATTGT
ACTAGGAGGCGTGTTTCTGTGCGGATATATTCAGACTTATTTAGAATGCA
ACAGAGAATTAGACATCGATAGGATGATAGAGGTCGTAAATCATCACCAT
GAGCCTGAATCGTCCTGGTTTGGTCGACTGTTAGGCTACATATACCAAGC
CTCACCAAAAACTAAGAAGATAGAAATGATCAAAAAATCCGCAAAAATCA
GCATTTCCATTTGCATGCCAGATCAAGTGTTCTTTATGTACATGAATAAC
ATATTTATCAAGCAGTTGGAAATCATGATAGAAAAGGTGTCGGTAACTAT
GACTAAACTGTCCTCCGGATTATCCTTCCCGTATAACCTCCTTGCACCAG
TCCTTTTGGTGTTTTTAGTGGGTTACACCATAAAGCTGTGCTTTAAATAC
ATTTTAAGCCCCCGAGCATGGGCGTCACTTTTACACAAGCCAGCGCCACA
AGGGACACCAACGATTCACCAGTCCATTAATGCACGGGCGCCCGAAGGCG
ACTCCATATCGGGCGACAACTTAAAGATGCTGCTAAATGTAATTAACGTG
AGAAATGTTCCAAAGGAGTCGCTACAGCGAATTCCAGACGTTTCGGGCGT
CCAAGAGCTAGAGGAAAAGCAGGAAGCTCCCACCACACCATCGAAAAAAG
AAAATTTAGATGAAAGCGATTCCAGCAGCAAAAGCAAGAGCAAAAGCTGT
GTAGCTGAAGATGAAGGATTCACGCTGGTCGACGATCACGAGGATAATAA
CATTGATAATGTGGCAAGCTTTCTAGACCAT

BO30190.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:10:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG12945-RB 1350 CG12945-PB 1..1347 17..1363 6735 100 Plus
CG12945-RC 1323 CG12945-PC 251..1320 294..1363 5350 100 Plus
CG12945-RC 1323 CG12945-PC 1..252 17..268 1260 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:10:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG12945-RB 2059 CG12945-RB 132..1478 17..1363 6735 100 Plus
CG12945-RC 2032 CG12945-RC 382..1451 294..1363 5350 100 Plus
CG12945-RC 2032 CG12945-RC 132..383 17..268 1260 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:10:49
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 9789433..9789881 1363..915 2245 100 Minus
3R 32079331 3R 9790839..9791090 268..17 1260 100 Minus
3R 32079331 3R 9790524..9790773 516..267 1250 100 Minus
3R 32079331 3R 9790319..9790462 656..513 720 100 Minus
3R 32079331 3R 9789954..9790088 914..780 660 99.3 Minus
3R 32079331 3R 9790138..9790265 783..656 640 100 Minus
Blast to na_te.dros performed on 2014-11-27 07:10:50 has no hits.

BO30190.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-12 10:52:38 Download gff for BO30190.complete
Subject Subject Range Query Range Percent Splice Strand
CG12945-RB 128..1474 17..1365 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:07:51 Download gff for BO30190.complete
Subject Subject Range Query Range Percent Splice Strand
CG12945-RB 132..1478 17..1365 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:05:00 Download gff for BO30190.complete
Subject Subject Range Query Range Percent Splice Strand
CG12945-RB 132..1478 17..1365 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:05:00 Download gff for BO30190.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9790839..9791090 17..268 100   Minus
3R 9790526..9790771 269..514 100 <- Minus
3R 9790320..9790460 515..655 100 <- Minus
3R 9790138..9790265 656..783 100 <- Minus
3R 9789954..9790084 784..914 100 <- Minus
3R 9789429..9789881 915..1365 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:07:51 Download gff for BO30190.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 5616561..5616812 17..268 100   Minus
arm_3R 5616248..5616493 269..514 100 <- Minus
arm_3R 5616042..5616182 515..655 100 <- Minus
arm_3R 5615860..5615987 656..783 100 <- Minus
arm_3R 5615676..5615806 784..914 100 <- Minus
arm_3R 5615151..5615603 915..1365 99 <- Minus

BO30190.pep Sequence

Translation from 16 to 1381

> BO30190.pep
MRTEAAVSCFLLVLHRVCCQSGNDESWLSPDPAWSDLVNDINQPGELCQC
PTCPDVSPVAMEDAVALTYFKKFVNLLFQRKRFQYDVMSAVHKRSLLFSL
IPSQLDELERVQDARDLDVLLTKILESAEEAPLFNGRSGCSYVRHGFFSL
LVDIFKDVIELTQTTEVKFILYATLAIALVVIVHKRFRVGLISIVLGGVF
LCGYIQTYLECNRELDIDRMIEVVNHHHEPESSWFGRLLGYIYQASPKTK
KIEMIKKSAKISISICMPDQVFFMYMNNIFIKQLEIMIEKVSVTMTKLSS
GLSFPYNLLAPVLLVFLVGYTIKLCFKYILSPRAWASLLHKPAPQGTPTI
HQSINARAPEGDSISGDNLKMLLNVINVRNVPKESLQRIPDVSGVQELEE
KQEAPTTPSKKENLDESDSSSKSKSKSCVAEDEGFTLVDDHEDNNIDNVA
SFLDH

BO30190.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:09:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG12945-PB 449 CG12945-PB 1..449 1..449 2316 100 Plus
CG12945-PC 440 CG12945-PC 1..440 1..449 2249 98 Plus