Clone BO30191 Report

Search the DGRC for BO30191

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:301
Well:91
Vector:pDNR-Dual
Associated Gene/Transcriptcomm-RA
Protein status:BO30191.pep: Imported from assembly
Sequenced Size:1144

Clone Sequence Records

BO30191.complete Sequence

1144 bp assembled on 2011-09-12

GenBank Submission: KX798044

> BO30191.complete
GAAGTTATCAGTCGACATGATTAGCACCACGGATTATCCAACAGTGGAGA
CCACCACAACTGCCGAAGAGCTCTATGCGGAGTACATATCCGCGCCGGCC
AGCAGCATGAGTCCCGCTGCAATTGCCGAGCACCTGCAGCAGAATCAGAT
CACCTTCGAGATACCCAGTGCCCACGATCTGCGACACATCGACGCCCTCA
ACTCCTTCAACGCCCTGCTCCAGAGGATTGGCAACGCAGCGGTGTCCTAC
GATCCCGCTCCACCCAGCGGCTGGTCTCCGGATGGCAGCATCAGCACCGA
GCAGCTCTCCAAGTCGGTGGTTCTGGATCTGGCCGACTTGCGGGATAGGT
CCGAGGAATCGGGCGAATCCTCGTGGTGGAGCCAGATCTTCGGGGATGCC
GACATGCATGTGATCATCAATTATCTGTGGATCGGAGTGGTCAGCTCGCT
GGTCATTCTGTCGCTGGTCTTCATCCTCTTCAGCTGCTACTTCTACAGGA
AGTTCCGCACTTGGAAAAAATGCAATAAGGACATACGTGCCCAGATCCAT
GCGGCCAGTGACTCGTACTCCTCGCACCTGGTTGGTTGCGATGCCAGCAG
ACTGCTGTTGCACCAGCAGATGCAGCATCCACATCATCGGAGCAGCGAGG
CTGGGTTCTACCAAATCGAATCGCCGCCCTGCTACACAATCGCCACCGGA
TTGCCCAGCTACGATGAGGCACTGCATCATCAGCCTCGGCACTTTGCCTA
CGGCATGAAGTTCGTTTATCCCTCGTTGGCGGCCGTGCATCATCATCACC
ATTGCATTTCCAATTGGGAGAAGCAGGAGCCGCTGAATAAGCTGCAAAAG
TGCAAGCTGTCAGCGGCAGCGGCAGTGGAGGAGGATAAAGCCGACTCCTC
ATCGTCCACGTCTGCATCCGCGTCGCCATCCTCTTCGGAATCCAGCAACT
TGGCCACAGCAACGCCTGCCATTTGCATTAACATGCCAAGTGGGCGGCAG
GATGAGGAGGTGGATAATTCAGATTCCGATTCCGCAATTGCAGTTGCAGT
GGCAGTAGCACAAAGTTTACAGCCGGCGGCGCCTGCCGACGATGATTGCG
CCTCATTGGTCGTTGTTGTTGCCGCGGCAAGCTTTCTAGACCAT

BO30191.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:11:21
Subject Length Description Subject Range Query Range Score Percent Strand
comm-RB 1113 CG17943-PB 1..1110 17..1126 5550 100 Plus
comm-RA 1113 CG17943-PA 1..1110 17..1126 5550 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:11:22
Subject Length Description Subject Range Query Range Score Percent Strand
comm-RB 2495 CG17943-RB 226..1336 16..1126 5555 100 Plus
comm-RA 1678 CG17943-RA 226..1336 16..1126 5555 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:11:20
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 15722670..15723271 1126..525 3010 100 Minus
3L 28110227 3L 15727692..15728205 529..16 2555 99.8 Minus
Blast to na_te.dros performed on 2014-11-27 07:11:20 has no hits.

BO30191.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-12 10:52:39 Download gff for BO30191.complete
Subject Subject Range Query Range Percent Splice Strand
comm-RA 351..1460 17..1128 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:08:08 Download gff for BO30191.complete
Subject Subject Range Query Range Percent Splice Strand
comm-RA 227..1336 17..1128 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:05:15 Download gff for BO30191.complete
Subject Subject Range Query Range Percent Splice Strand
comm-RA 227..1336 17..1128 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:05:15 Download gff for BO30191.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15727697..15728204 17..524 100   Minus
3L 15722667..15723271 525..1128 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:08:08 Download gff for BO30191.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 15720797..15721304 17..524 100   Minus
arm_3L 15715767..15716371 525..1128 99 <- Minus

BO30191.pep Sequence

Translation from 16 to 1144

> BO30191.pep
MISTTDYPTVETTTTAEELYAEYISAPASSMSPAAIAEHLQQNQITFEIP
SAHDLRHIDALNSFNALLQRIGNAAVSYDPAPPSGWSPDGSISTEQLSKS
VVLDLADLRDRSEESGESSWWSQIFGDADMHVIINYLWIGVVSSLVILSL
VFILFSCYFYRKFRTWKKCNKDIRAQIHAASDSYSSHLVGCDASRLLLHQ
QMQHPHHRSSEAGFYQIESPPCYTIATGLPSYDEALHHQPRHFAYGMKFV
YPSLAAVHHHHHCISNWEKQEPLNKLQKCKLSAAAAVEEDKADSSSSTSA
SASPSSSESSNLATATPAICINMPSGRQDEEVDNSDSDSAIAVAVAVAQS
LQPAAPADDDCASLVVVVAAASFLDH

BO30191.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:09:30
Subject Length Description Subject Range Query Range Score Percent Strand
comm-PB 370 CG17943-PB 1..370 1..370 1923 100 Plus
comm-PA 370 CG17943-PA 1..370 1..370 1923 100 Plus
comm2-PA 343 CG7554-PA 101..300 117..364 165 25.3 Plus