Clone BO30201 Report

Search the DGRC for BO30201

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:302
Well:1
Vector:pDNR-Dual
Associated Gene/TranscriptCG9498-RA
Protein status:BO30201.pep: Imported from assembly
Sequenced Size:1306

Clone Sequence Records

BO30201.complete Sequence

1306 bp assembled on 2011-09-12

GenBank Submission: KX798841

> BO30201.complete
GAAGTTATCAGTCGACATGGTGGTCATTAAGAACGAGCAGAATATCTCGG
TGCCCGAGTATCTCAACGAGCACTTCTTCACAGAGACCCTGGAGGAGGGT
TTGCGGGAGTCGAAGGTGACCCTGAAGGAGATCAATTTTGCGTGGGGCAG
CAATCCGGGGGACAACTATTGCTCGGCTATCTATCGTGTCGGAGTCTCGT
TCGCTAGATGGGCCGACGGTGGGGAATCCCCGGTGACGGAGCAGCTTTCG
CTAATTGTGAAGACCATTCCGATCACCGAAGCCACTCAGTTTCTGGAGGA
TGTCTGTGTGTTCATCAAGGAGAAGCAGACCTACACTGATGTCTTGCCGC
GATTGGATATCCTCAGCCGTGGCGACACATTCGGAGCAAAATACTATCAC
TCTGTGAAGACTCCGGTGCAAACGATCGTGTTCAGTGACCTCACGGTAGA
GGGATTCAAGGTGGCCTCGCGTGAAAAAGGCCTGGACTGGAACCACGCCT
CACTCATTCTTCAGCAACTGGGAAAGTTCCATGCCACCTCCATGGTGCTG
GCCAAGAAGGATCCCGCTATTGTGAAGCAATACACGCGTGGCATGCTCAG
CGAGGACATCCTGATGAAGAGCGACACCTTCGAGCAAATGTTCGGCGGCT
TCCTCAAGGGCCTCATCAAGAGCTCAGCGAGCTGGGCCGGCTACGAGAAG
ATTAGCAAGCACTTGCAGCGCCTTATGGACAACTTCCGGAACGTGTGTGC
GGATGCGCCCAGGCCGAGGAAGGGTGATCGCTACGTGGTGCTCAACCACG
GGGATTTGTGGACCAATAACTTCATGTACGGATACGATAACGCTTCACAG
CCGGACGTTCCCACGCGTGCCATCTTCGTGGACTTCCAACTCAGCTTCTA
TGGCAGTCCGGCCTGCGATCTGAACTTCTTCCTGAACACCAGCATCAAGC
TGCAATTGCTGCAGGAGCGCCGCGAGGAGCTCATCAAGGTGTACTATGCA
TCCTTCAAGGATGCTCTGGAGTACGCCCGCTTCGAGGACATTCCCAGCTA
TGAGGATCTGCAGTACGAGCTGCGCAGCCGCGAAACCTACGGACTTTTCG
GCATGTTCGCCTTCCTGCCCATGATCACCATGCCCAAGGAGCTGGCCCAG
GACAACAGCATTGAGAACATGCAGGACGAGGCCTTCAAGCAGCGCAAGAT
GGATGCCATCTTCTCGCAAAAGTTCCTGAACGACCACCAAAAGTGGGCTC
TGAAGCGAGCTGATTCACTTGGCGTCTTCGGGGACTACGCAAGCTTTCTA
GACCAT

BO30201.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:37:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG9498-RA 1275 CG9498-PA 1..1272 17..1288 6360 100 Plus
CG13360-RA 1266 CG13360-PA 846..930 868..952 185 81.2 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:37:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG9498-RA 1514 CG9498-RA 69..1345 12..1288 6370 99.9 Plus
CG13360-RA 1603 CG13360-RA 921..1005 868..952 185 81.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 06:37:12
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 6349562..6350292 1288..558 3655 100 Minus
2L 23513712 2L 6350588..6350966 390..12 1880 99.7 Minus
2L 23513712 2L 6350354..6350523 560..391 850 100 Minus
Blast to na_te.dros performed on 2014-11-27 06:37:13 has no hits.

BO30201.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-12 10:52:55 Download gff for BO30201.complete
Subject Subject Range Query Range Percent Splice Strand
CG9498-RA 68..1339 17..1290 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:48:34 Download gff for BO30201.complete
Subject Subject Range Query Range Percent Splice Strand
CG9498-RA 74..1345 17..1290 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:49:50 Download gff for BO30201.complete
Subject Subject Range Query Range Percent Splice Strand
CG9498-RA 74..1345 17..1290 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 07:49:50 Download gff for BO30201.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6350588..6350961 17..390 100   Minus
2L 6350355..6350523 391..559 100 <- Minus
2L 6349559..6350290 560..1290 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:48:34 Download gff for BO30201.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 6350588..6350961 17..390 100   Minus
arm_2L 6350355..6350523 391..559 100 <- Minus
arm_2L 6349559..6350290 560..1290 99 <- Minus

BO30201.pep Sequence

Translation from 16 to 1306

> BO30201.pep
MVVIKNEQNISVPEYLNEHFFTETLEEGLRESKVTLKEINFAWGSNPGDN
YCSAIYRVGVSFARWADGGESPVTEQLSLIVKTIPITEATQFLEDVCVFI
KEKQTYTDVLPRLDILSRGDTFGAKYYHSVKTPVQTIVFSDLTVEGFKVA
SREKGLDWNHASLILQQLGKFHATSMVLAKKDPAIVKQYTRGMLSEDILM
KSDTFEQMFGGFLKGLIKSSASWAGYEKISKHLQRLMDNFRNVCADAPRP
RKGDRYVVLNHGDLWTNNFMYGYDNASQPDVPTRAIFVDFQLSFYGSPAC
DLNFFLNTSIKLQLLQERREELIKVYYASFKDALEYARFEDIPSYEDLQY
ELRSRETYGLFGMFAFLPMITMPKELAQDNSIENMQDEAFKQRKMDAIFS
QKFLNDHQKWALKRADSLGVFGDYASFLDH

BO30201.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:10:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG9498-PA 424 CG9498-PA 1..424 1..424 2217 100 Plus
CG13360-PA 421 CG13360-PA 15..420 13..421 937 47.1 Plus
CG9497-PB 417 CG9497-PB 11..415 10..420 752 40.1 Plus
CG9497-PA 417 CG9497-PA 11..415 10..420 752 40.1 Plus
CG7135-PA 417 CG7135-PA 9..416 13..421 635 36.3 Plus