Clone BO30202 Report

Search the DGRC for BO30202

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:302
Well:2
Vector:pDNR-Dual
Associated Gene/TranscriptCG12038-RA
Protein status:BO30202.pep: Imported from assembly
Sequenced Size:1255

Clone Sequence Records

BO30202.complete Sequence

1255 bp assembled on 2011-09-12

GenBank Submission: KX795053

> BO30202.complete
GAAGTTATCAGTCGACATGTTGACCGCCCTGCGTCGGAAAATTCGGTTCG
GAATGCAGCGCACGGTTTTAATTGCGGTCCTGCTGGCGGTGGGCATTTTC
AGCTACGCCTTTCTCAACCTCAAGTTCTGCTTCAAGTTGATGTCCCATCG
GAGCCTCAACTTGATGTGCCAGAAATTCGAAAAACATGAGTACAGCGGCT
CTCTGTGTGAGGAACTCTGTGGTTCCCAATCTTCCTTCGACAACTTTCAG
TGTCCGCTGAATGATATGAAAACTATCCTCTTTACGGCCGAAAAGAACGG
CGACTTGTATGCGGTGAAGCTGGCCCGGCACAACGATGACGAGCTGAGCT
GGACGAACAACAAGGGGGAGTCGATATACCCCAAGCTCGAGGAGTTCCAC
GAGATCGTGAAGCTGCACATCATTCTGGCGTACAATGTCACCCTGGATGA
TAATATGATCCGCGCTCTGGTCAACCAGGAAATAGCCGATGATAACTCGC
AGCAGATGGTCAGTTTTTGGCGGCTCTTCAAGGACAACAACTACATGATG
GGCAAACTTTTCGACGAGGAATCCATCTTTCCGGCTGTGCTGGGCTCCTG
TGGACCCTACTACGCCACTGAGGGACTGGAGATTGTGCAGTCCAACCCCA
GCATAATGCAGTATCTGGCCTCCAATCGCGTGCAGCGGCTGAAGCATGCT
CTCAATATTATGGAGTACATTTTCCGACTGGACGAAATGAAGCCGGAGCC
GCTGAAGATGTGCAAGATGCAGGTGAATCGCTTCGGAACCGCCTCTGAGC
GAAGACTGAAGTACCAGAGTGCCGAGCACGTCTATGTGGAGAGCCAGCTG
GACAAGCGATTGTCCAGGGGCGTCAAGTGCCACGCCCACCAGGACTGCCA
CTTCCACTCCTGCCGAGGATTGTGTGACGAGGAGAAGCAATCCTGCACGC
ACATTCAGCAGAACAACAACTTCCAGATTTTCTGCGAGCACATCCTACTG
GGCGGAGGCACATTTCAGCCCGGCCTCCTCAGCGGAGTGCGCCTCTCCAA
GGCGCTCCAGAAGCTGGTCAAGATGTGCGTCCAGCCGCCCAAGGAGCATC
AAGTGCCAGGACGCCAGTGGGCACCCAACACGCAGCTCGCCCTGAGGCTC
TACAACGAGCTGAAGCAACTGCATCAGGCTGCAACAGCATCCGCAGGATC
CGTGATTCCCGACGAGGGACAGGCACGTCGGGGAGTCGCAAGCTTTCTAG
ACCAT

BO30202.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:37:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG12038-RA 1224 CG12038-PA 1..1221 17..1237 6105 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:37:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG12038-RA 1456 CG12038-RA 79..1299 17..1237 6105 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 06:37:27
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 994976..995546 667..1237 2855 100 Plus
3L 28110227 3L 994707..994917 457..667 1055 100 Plus
3L 28110227 3L 994276..994429 166..319 770 100 Plus
3L 28110227 3L 994061..994210 17..166 750 100 Plus
3L 28110227 3L 994501..994640 318..457 700 100 Plus
Blast to na_te.dros performed on 2014-11-27 06:37:28 has no hits.

BO30202.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-12 10:52:56 Download gff for BO30202.complete
Subject Subject Range Query Range Percent Splice Strand
CG12038-RA 79..1294 22..1239 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:48:44 Download gff for BO30202.complete
Subject Subject Range Query Range Percent Splice Strand
CG12038-RA 84..1299 22..1239 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:49:57 Download gff for BO30202.complete
Subject Subject Range Query Range Percent Splice Strand
CG12038-RA 84..1299 22..1239 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 07:49:57 Download gff for BO30202.complete
Subject Subject Range Query Range Percent Splice Strand
3L 994976..995546 667..1239 99   Plus
3L 994708..994916 458..666 100 -> Plus
3L 994503..994640 320..457 100 -> Plus
3L 994277..994429 167..319 100 -> Plus
3L 994066..994210 22..166 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:48:44 Download gff for BO30202.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 994976..995546 667..1239 99   Plus
arm_3L 994708..994916 458..666 100 -> Plus
arm_3L 994503..994640 320..457 100 -> Plus
arm_3L 994277..994429 167..319 100 -> Plus
arm_3L 994066..994210 22..166 100 -> Plus

BO30202.pep Sequence

Translation from 16 to 1255

> BO30202.pep
MLTALRRKIRFGMQRTVLIAVLLAVGIFSYAFLNLKFCFKLMSHRSLNLM
CQKFEKHEYSGSLCEELCGSQSSFDNFQCPLNDMKTILFTAEKNGDLYAV
KLARHNDDELSWTNNKGESIYPKLEEFHEIVKLHIILAYNVTLDDNMIRA
LVNQEIADDNSQQMVSFWRLFKDNNYMMGKLFDEESIFPAVLGSCGPYYA
TEGLEIVQSNPSIMQYLASNRVQRLKHALNIMEYIFRLDEMKPEPLKMCK
MQVNRFGTASERRLKYQSAEHVYVESQLDKRLSRGVKCHAHQDCHFHSCR
GLCDEEKQSCTHIQQNNNFQIFCEHILLGGGTFQPGLLSGVRLSKALQKL
VKMCVQPPKEHQVPGRQWAPNTQLALRLYNELKQLHQAATASAGSVIPDE
GQARRGVASFLDH

BO30202.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:10:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG12038-PA 407 CG12038-PA 1..407 1..407 2148 100 Plus