Clone BO30211 Report

Search the DGRC for BO30211

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:302
Well:11
Vector:pDNR-Dual
Associated Gene/TranscriptCG5909-RA
Protein status:BO30211.pep: Imported from assembly
Sequenced Size:1177

Clone Sequence Records

BO30211.complete Sequence

1177 bp assembled on 2011-09-12

GenBank Submission: KX795221

> BO30211.complete
GAAGTTATCAGTCGACATGGTGTCTGCGGCGATTCGACTTGGACTGCTCT
TGTGCATCTTGCCCCAGCTGGTCATCAGCCAGAGCAGCTGCGTCACGCCG
GCCCAAGCAGCCGGTCAGTGCATCCGATACCAGGAGTGCCCCTTCGTGCA
GAAGATTCTCGGGATCTACGGTCGGAATATACCACGGAAAATCCACAACC
AAATTAGTGAGATGCAGTGCAGGAGCACTACGAATACGAGGGACTTCCAT
CTTTGTTGCCCCAACGAGGCACCTCCTCAATCCAATCAGGAGTCGCAGAG
GAAGGTCGTGCGATCGGAGGGCGGAAATCTGAACCGGTATGATCGCCAGG
GTCTGCAGCTGCTGAACTCGGTGACCAACTGCGGCAACAAGGGCAATCCC
AAGGTGAGCGGTGGAAAGACGGCCAGGCCAGGCGACTTTCCCTGGGTGGC
CCTGCTCAAGTACAAGATCAACGATCCGCGTCCATTCCGCTGCGGCGGCA
GCCTCATCAGCGAACGCCACATCCTGACCGCCGCCCACTGCATCATCGAT
CAGCCCGAAGTAATCGCGGTGCGCCTGGGCGAGCATGACCTGGAATCGGA
GGAGGACTGCCACTATTTGGGCGGTACGAACCGCGTATGCATTCCGCCCT
ACGAGGAGTACGGCATAGAGCAGATACGAGTACATCCCAACTACGTGCAT
GGCAAGATCAGCCATGACGTTGCCATCATCAAGCTGGATCGCGTGGTCAA
GGAAAAATCGCATATTAAGCCCGTTTGCCTGCCAATCGACCAGAAGTCAC
AGGAACTGGACTTCGATCAGAGCTTCTTCGTCGCCGGCTGGGGCGGCACC
GAGAAGGAGACTGTGGCCACCAAGCTCCAACAGGCGCTGATCACCAGGAA
GAGCCTGAACGAGTGTCGCCAGTACTACAACAAGGGTGAGGTGAGCGACA
ACCACATCTGCGCCACAGGAACTGGGATCAAGCACACTTGCCAGGGAGAT
TCCGGCGGACCGGTGTTCTTCAAGCATCGCTTCAAGAACACCTACCGAGT
GGTCCAGTACGGTGTGGTCTCCTTCGGCGGACGGCTATGCGGACAGAACC
AGCCAGGAGTCTTCGCCAGTGTCATCGACATGCTGCCCTGGATCACGCAG
AACCTTCAGGCAAGCTTTCTAGACCAT

BO30211.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:36:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG5909-RA 1146 CG5909-PA 1..1143 17..1159 5715 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:36:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG5909-RA 1455 CG5909-RA 168..1320 7..1159 5720 99.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 06:36:52
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 27162179..27162776 562..1159 2990 100 Plus
3R 32079331 3R 27161739..27162059 241..561 1605 100 Plus
3R 32079331 3R 27161455..27161616 81..242 810 100 Plus
3R 32079331 3R 27161325..27161398 7..80 325 95.9 Plus
Blast to na_te.dros performed on 2014-11-27 06:36:53 has no hits.

BO30211.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-12 10:52:54 Download gff for BO30211.complete
Subject Subject Range Query Range Percent Splice Strand
CG5909-RA 178..1320 17..1161 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:48:23 Download gff for BO30211.complete
Subject Subject Range Query Range Percent Splice Strand
CG5909-RA 178..1320 17..1161 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:49:42 Download gff for BO30211.complete
Subject Subject Range Query Range Percent Splice Strand
CG5909-RA 178..1320 17..1161 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 07:49:42 Download gff for BO30211.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27162179..27162776 562..1161 99   Plus
3R 27161740..27162059 242..561 100 -> Plus
3R 27161455..27161615 81..241 100 -> Plus
3R 27161335..27161398 17..80 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:48:23 Download gff for BO30211.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 22987901..22988498 562..1161 99   Plus
arm_3R 22987462..22987781 242..561 100 -> Plus
arm_3R 22987177..22987337 81..241 100 -> Plus
arm_3R 22987057..22987120 17..80 100 -> Plus

BO30211.pep Sequence

Translation from 16 to 1177

> BO30211.pep
MVSAAIRLGLLLCILPQLVISQSSCVTPAQAAGQCIRYQECPFVQKILGI
YGRNIPRKIHNQISEMQCRSTTNTRDFHLCCPNEAPPQSNQESQRKVVRS
EGGNLNRYDRQGLQLLNSVTNCGNKGNPKVSGGKTARPGDFPWVALLKYK
INDPRPFRCGGSLISERHILTAAHCIIDQPEVIAVRLGEHDLESEEDCHY
LGGTNRVCIPPYEEYGIEQIRVHPNYVHGKISHDVAIIKLDRVVKEKSHI
KPVCLPIDQKSQELDFDQSFFVAGWGGTEKETVATKLQQALITRKSLNEC
RQYYNKGEVSDNHICATGTGIKHTCQGDSGGPVFFKHRFKNTYRVVQYGV
VSFGGRLCGQNQPGVFASVIDMLPWITQNLQASFLDH

BO30211.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:10:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG5909-PA 381 CG5909-PA 1..381 1..381 2052 100 Plus
grass-PB 377 CG5896-PB 32..377 25..385 512 32.8 Plus
grass-PA 335 CG5896-PA 20..335 52..385 485 33.3 Plus
Sp7-PF 391 CG3066-PF 12..390 10..381 433 30.8 Plus
Sp7-PE 391 CG3066-PE 12..390 10..381 433 30.8 Plus