Clone BO30215 Report

Search the DGRC for BO30215

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:302
Well:15
Vector:pDNR-Dual
Associated Gene/TranscriptEip71CD-RA
Protein status:BO30215.pep: Imported from assembly
Sequenced Size:772

Clone Sequence Records

BO30215.complete Sequence

772 bp assembled on 2011-09-12

GenBank Submission: KX798702

> BO30215.complete
GAAGTTATCAGTCGACATGTCTCTGACTATTACTTCCAGTGTCACTCATC
CTGAGCTCAAGGATCTGAGCACCGTTCGCAATGAACAAAAGGAACTGAAC
ATTTCGCCGGTTCACGATGTGAATGTCACAAAAGCCACGGCCACTTTCGG
CATGGGTTGCTTTTGGGGCGCAGAATCCCTGTATGGAGCCACCCGTGGAG
TTTTGAGAACCACCGTGGGCTACGCCGGAGGCAGCTCGGATTTGCCAACG
TACCGTAAAATGGGCGATCATACGGAGGTGCTGGAAATCGACTATGATCC
CACGGTCATTAGCTTTAAGGAGCTGCTGGATCTGTTCTGGAACAACCATG
AGTATGGCCTGACCACGCCCATCAAGAGGCAGTACGCCTCCTTGATTCTG
TACCACGATGAGGAGCAGAAGCAGGTGGCACACGCCTCCAAATTGGAGGA
GCAAGAGCGCCGTGCACCGGAGATCATAACCACTGAGATTGCATCCAAGG
AGAACTTTTACCCAGCCGAGGCGTACCACCAGAAGTATAGGTTGCAGGGC
CACAAGGATCTCGCCTCATCGCTAAATCTCAGCCCCAAACTGCTGCAGAC
CAGCTATGTGGCCACCAAACTGAATGGCTACCTGGCCGGAGTCGGCGGCA
TCGAGCAGTTTAAGGCGGAGGCGGAGACCATGGGTCTGACGCCCACCCAG
CGGCAGTACTGCTACTACCACGTGGAGCAGAACGAGGGCCAGGGTCTCTA
CTGCGCAAGCTTTCTAGACCAT

BO30215.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:38:15
Subject Length Description Subject Range Query Range Score Percent Strand
Eip71CD-RG 786 CG7266-PG 1..738 17..754 3675 99.9 Plus
Eip71CD-RA 741 CG7266-PA 1..738 17..754 3675 99.9 Plus
Eip71CD-RB 729 CG7266-PB 1..726 17..754 3460 98.2 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:38:16
Subject Length Description Subject Range Query Range Score Percent Strand
Eip71CD-RG 980 CG7266-RG 67..805 16..754 3680 99.9 Plus
Eip71CD-RA 980 CG7266-RA 67..805 16..754 3680 99.9 Plus
Eip71CD-RB 968 CG7266-RB 67..793 16..754 3465 98.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 06:38:13
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 15512476..15512739 262..525 1320 100 Plus
3L 28110227 3L 15512796..15513027 523..754 1160 100 Plus
3L 28110227 3L 15512171..15512366 67..262 965 99.5 Plus
3L 28110227 3L 15511118..15511169 16..67 260 100 Plus
Blast to na_te.dros performed on 2014-11-27 06:38:14 has no hits.

BO30215.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-12 10:52:58 Download gff for BO30215.complete
Subject Subject Range Query Range Percent Splice Strand
Eip71CD-RA 67..804 17..756 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:49:12 Download gff for BO30215.complete
Subject Subject Range Query Range Percent Splice Strand
Eip71CD-RA 68..805 17..756 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:50:21 Download gff for BO30215.complete
Subject Subject Range Query Range Percent Splice Strand
Eip71CD-RA 68..805 17..756 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 07:50:21 Download gff for BO30215.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15512796..15513027 523..756 99   Plus
3L 15512476..15512736 262..522 100 -> Plus
3L 15512172..15512365 68..261 99 -> Plus
3L 15511119..15511169 17..67 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:49:12 Download gff for BO30215.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 15505896..15506127 523..756 99   Plus
arm_3L 15505576..15505836 262..522 100 -> Plus
arm_3L 15505272..15505465 68..261 99 -> Plus
arm_3L 15504219..15504269 17..67 100 -> Plus

BO30215.pep Sequence

Translation from 16 to 772

> BO30215.pep
MSLTITSSVTHPELKDLSTVRNEQKELNISPVHDVNVTKATATFGMGCFW
GAESLYGATRGVLRTTVGYAGGSSDLPTYRKMGDHTEVLEIDYDPTVISF
KELLDLFWNNHEYGLTTPIKRQYASLILYHDEEQKQVAHASKLEEQERRA
PEIITTEIASKENFYPAEAYHQKYRLQGHKDLASSLNLSPKLLQTSYVAT
KLNGYLAGVGGIEQFKAEAETMGLTPTQRQYCYYHVEQNEGQGLYCASFL
DH

BO30215.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:10:32
Subject Length Description Subject Range Query Range Score Percent Strand
Eip71CD-PA 246 CG7266-PA 1..246 1..246 1292 100 Plus
Eip71CD-PG 261 CG7266-PG 1..246 1..246 1292 100 Plus
Eip71CD-PB 242 CG7266-PB 1..242 1..246 1255 98.4 Plus
Eip71CD-PF 245 CG7266-PF 16..245 17..246 1213 100 Plus
Eip71CD-PE 239 CG7266-PE 11..239 18..246 1209 100 Plus