Clone BO30217 Report

Search the DGRC for BO30217

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:302
Well:17
Vector:pDNR-Dual
Associated Gene/TranscriptCG9422-RA
Protein status:BO30217.pep: Imported from assembly
Sequenced Size:652

Clone Sequence Records

BO30217.complete Sequence

652 bp assembled on 2011-09-12

GenBank Submission: KX798456

> BO30217.complete
GAAGTTATCAGTCGACATGATGCACTACCGCAAGGCCGAGAATGTGGAGA
AGGAGCTGAGCAAGAGCGATCTGCCATTCGAGGACTGCATGCCAAAGTCC
CAAAAGGATTTTTTGTGGATGCATGTAAAAGGCGGTACCAAAGTGAGCAA
TGTGATTGAGTTTGCTCAGGAGGCGCTGAACAAGGGCGAGCACAGATGCG
TGGTGTGGAGCGGATCCGGCGGAGGAGTGGTGAAGACCATATCCTGTGCC
GAGGTCCTCAAGCGGAGCCACCCCCTCTACCAGGTGACGCGCATGGCCTA
CACCAGTGTGGAGGAGCACTGGAAGCCGCAAATGGAAGGCCTGGAGGAGA
TTATAGTCACACGCCAAATACCCACCCTGCACATCCTCATGAGTCTGGAC
GAGCTGCCGGATACTATAGATGGCTTACAAAAGCCAAATACGTCCACTGA
TTTTTGGGATGGCGGAGGAGCACAGCAACAGCCACATCCACGTTCCCAGC
CCCGCCATCAGCAGCAGCCACATAAACCAGGGGCTGGGCGTGGGGGTCGG
CCGAACAAACGGACCAGACCCGGACGCAATAAACCAGGCCAACAACCCGA
AAAACCTGCCGCTGAAGAGAATTTACCCGCCAGTGCAAGCTTTCTAGACC
AT

BO30217.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:38:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG9422-RD 621 CG9422-PD 1..618 17..634 3090 100 Plus
CG9422-RC 621 CG9422-PC 1..618 17..634 3090 100 Plus
CG9422-RA 621 CG9422-PA 1..618 17..634 3090 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:38:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG9422-RD 1310 CG9422-RD 606..1223 17..634 3090 100 Plus
CG9422-RC 1388 CG9422-RC 112..729 17..634 3090 100 Plus
CG9422-RA 816 CG9422-RA 112..729 17..634 3090 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 06:38:31
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 6692292..6692503 423..634 1060 100 Plus
2R 25286936 2R 6691882..6692063 125..306 910 100 Plus
2R 25286936 2R 6692118..6692236 305..423 595 100 Plus
2R 25286936 2R 6691718..6691827 17..126 550 100 Plus
Blast to na_te.dros performed 2014-11-27 06:38:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2455..2512 466..522 116 69 Plus

BO30217.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-12 10:52:58 Download gff for BO30217.complete
Subject Subject Range Query Range Percent Splice Strand
CG9422-RC 79..696 17..636 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:49:22 Download gff for BO30217.complete
Subject Subject Range Query Range Percent Splice Strand
CG9422-RA 112..729 17..636 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:50:31 Download gff for BO30217.complete
Subject Subject Range Query Range Percent Splice Strand
CG9422-RA 112..729 17..636 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 07:50:31 Download gff for BO30217.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6692293..6692503 424..636 99   Plus
2R 6692120..6692236 307..423 100 -> Plus
2R 6691882..6692063 125..306 100 -> Plus
2R 6691718..6691825 17..124 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:49:22 Download gff for BO30217.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 2579798..2580008 424..636 99   Plus
arm_2R 2579625..2579741 307..423 100 -> Plus
arm_2R 2579387..2579568 125..306 100 -> Plus
arm_2R 2579223..2579330 17..124 100 -> Plus

BO30217.pep Sequence

Translation from 16 to 652

> BO30217.pep
MMHYRKAENVEKELSKSDLPFEDCMPKSQKDFLWMHVKGGTKVSNVIEFA
QEALNKGEHRCVVWSGSGGGVVKTISCAEVLKRSHPLYQVTRMAYTSVEE
HWKPQMEGLEEIIVTRQIPTLHILMSLDELPDTIDGLQKPNTSTDFWDGG
GAQQQPHPRSQPRHQQQPHKPGAGRGGRPNKRTRPGRNKPGQQPEKPAAE
ENLPASASFLDH

BO30217.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:10:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG9422-PD 206 CG9422-PD 1..206 1..206 1117 100 Plus
CG9422-PC 206 CG9422-PC 1..206 1..206 1117 100 Plus
CG9422-PA 206 CG9422-PA 1..206 1..206 1117 100 Plus