Clone BO30218 Report

Search the DGRC for BO30218

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:302
Well:18
Vector:pDNR-Dual
Associated Gene/TranscriptCG7671-RA
Protein status:BO30218.pep: Imported from assembly
Sequenced Size:1108

Clone Sequence Records

BO30218.complete Sequence

1108 bp assembled on 2011-09-12

GenBank Submission: KX800014

> BO30218.complete
GAAGTTATCAGTCGACATGTCCATTGCAAACGTTTCCACGCACTACATAT
CCGAGAAGGTGTCCCAAGTGCGCTGGCTTCCGGAGGAACTGCAGCAGAGC
GAACGGTTCGTTACTGGAAGCTGGGACATGGACCAGAACTTCGTGCGCCT
CTGGCGGCTACAATCGAACCAATATGTCACCGCCACGGATTCGGAAGTGG
ACCAGATACCTCGCTGCATGGACAAGGTGAGAATGGAGGACGATGTGACC
GCCATGGAGTTCGTCGACAAGGACACGCTGGCTGTGAGCTGTGCCGATGG
TCATCTCAGCGTGTTTAACGTCCATCGAGCCGTGGAGGAGGATCAGATGC
AACGTACGTCCCGATCGGGACGTCTGCACTGCTTCCAACGTAGCCAGGAG
CCCGCTCCTTGCACCGACCTTTCTGTTTACGGCACGGATATCGCCACCGC
CGGCGAGGATGGGTGTGTAAGCATCGTCTCCGTGGAAAATGTGCGCCAGG
TGAAGCGACAGATTGAGGCGGACAGCATGGCGCTGTTTTCCATTTGCTAT
ATCAGCCAGCAGGAACTGGTGACTGCCAATAGGATGGGTGTTATCCGAAT
GCTGGACGCCCGAGTGGCCACTGAAGCGCAGCCGAAGACCACCTTTATGG
TGGCCTCCCAGGATGACAAGTCGAACTTTGTCTCGTCCCTTGCCAAGCAT
CCGATGCAGCAACATATTTTACTTTGCGGCAGCGAAGAGGGTTCCATAAC
CGTCTGGGATATGCGAAACCTCAGTTATCCCGCCTCCTATCTCAGCGCTC
ACAAAAGTCCCATCAACGAGATAGGCTTCCATCAAAAGGATCCCAGCAAA
CTGTTCACCGCCGCAGAAGGTGGCGAGGTGTGGATGTGGTCAGAGAACAA
AGTTCTCGGGTGCGACTATAACAAAGACGGACACAGCCCCTGGTTGTCTG
GCGATCGTGTTCGCTCCCTGGTCGATGTGGAGGGAGTGCTGAGTAATGTT
CGCAAGTCCATCAACTCCTTCGATGTGCATGGAAGTCGTCTGGTCTGCGG
AGGCGACACAGAAGCCGTTTACCTAGTTGATAATATTGTTGCAAGCTTTC
TAGACCAT

BO30218.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:38:51
Subject Length Description Subject Range Query Range Score Percent Strand
Nup43-RA 1077 CG7671-PA 1..1074 17..1090 5370 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:38:52
Subject Length Description Subject Range Query Range Score Percent Strand
Nup43-RA 1211 CG7671-RA 83..1156 17..1090 5370 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 06:38:50
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 18367067..18367858 299..1090 3960 100 Plus
3R 32079331 3R 18366720..18367006 17..303 1435 100 Plus
Blast to na_te.dros performed on 2014-11-27 06:38:50 has no hits.

BO30218.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-12 10:52:59 Download gff for BO30218.complete
Subject Subject Range Query Range Percent Splice Strand
CG7671-RA 65..1138 17..1092 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:49:35 Download gff for BO30218.complete
Subject Subject Range Query Range Percent Splice Strand
Nup43-RA 83..1156 17..1092 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:50:38 Download gff for BO30218.complete
Subject Subject Range Query Range Percent Splice Strand
Nup43-RA 83..1156 17..1092 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 07:50:38 Download gff for BO30218.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18367068..18367858 300..1092 99   Plus
3R 18366720..18367002 17..299 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:49:35 Download gff for BO30218.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 14192790..14193580 300..1092 99   Plus
arm_3R 14192442..14192724 17..299 100 -> Plus

BO30218.pep Sequence

Translation from 16 to 1108

> BO30218.pep
MSIANVSTHYISEKVSQVRWLPEELQQSERFVTGSWDMDQNFVRLWRLQS
NQYVTATDSEVDQIPRCMDKVRMEDDVTAMEFVDKDTLAVSCADGHLSVF
NVHRAVEEDQMQRTSRSGRLHCFQRSQEPAPCTDLSVYGTDIATAGEDGC
VSIVSVENVRQVKRQIEADSMALFSICYISQQELVTANRMGVIRMLDARV
ATEAQPKTTFMVASQDDKSNFVSSLAKHPMQQHILLCGSEEGSITVWDMR
NLSYPASYLSAHKSPINEIGFHQKDPSKLFTAAEGGEVWMWSENKVLGCD
YNKDGHSPWLSGDRVRSLVDVEGVLSNVRKSINSFDVHGSRLVCGGDTEA
VYLVDNIVASFLDH

BO30218.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:10:36
Subject Length Description Subject Range Query Range Score Percent Strand
Nup43-PA 358 CG7671-PA 1..358 1..358 1869 100 Plus