Clone BO30219 Report

Search the DGRC for BO30219

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:302
Well:19
Vector:pDNR-Dual
Associated Gene/TranscriptCG18003-RB
Protein status:BO30219.pep: Imported from assembly
Sequenced Size:1132

Clone Sequence Records

BO30219.complete Sequence

1132 bp assembled on 2011-09-12

GenBank Submission: KX797824

> BO30219.complete
GAAGTTATCAGTCGACATGGCTTTGGTTTGCGTAGAGGACTTTGAAAAGA
AGGCCGTTGGGCAACTGGAGAAGAATGCCCTGGACTACTACCGTAGCGGA
GCCGGTGAGCAGTTCACCTTGGGACTGAATCGCGAGGCCTTCCGCCGGCT
ACGCTTGCGACCTCGTTGTTTGAGAGATGTCTCCCGCCTGGACATTAGTA
CCAAGATCTTCGGCGAGCAGATGCAGTGGCCTCTGGGCATTGCTCCGACG
GCTATGCAGAAGATGGCCCATCCGGACGGCGAGGTAGGCAATGCCAGGGC
GGCCGGAAAAGCCGGCTCCATCTTTATACTCAGCACACTGTCCACCACTT
CGCTGGAGGATTTGGCAGCCGGTGCCCCGGATACCATCAAATGGTTCCAA
CTGTACATCTACAAGGATCGTACCATAACGGAAAAGCTGGTACGTCGTGC
CGAGAAGGCGAACTTCAAAGCGCTCGTCCTGACCATCGATGCTCCAATCT
TTGGACACCGTAGAGCCGATGTGCGCAACAACTTCAGCTTGCCGTCGCAC
CTGTCATTGGCCAATTTCCAGGGCGTTAAGGCTACTGGAGTGGGTAATGC
CGCTATGGGCGCCTCAGGCATTAATGAGTACGTCTCCAGCCAGTTTGATC
CAACCATAACCTGGAAGGATATTGCCTGGTTGAAGGGCATCACTCATCTG
CCCATTGTGGTCAAGGGAGTGCTGACTGCCGAAGATGCTGTGTTGGCCCA
GGAGTTTGGATGCGCCGGACTCATTGTTTCCAACCACGGTGCTCGTCAGA
TCGATACGGTTCCGGCCTCGATCGAAGCCCTGCCGGAGATCGTAAAGGCC
GTGGGAGATAATCTGGTGGTTATGCTGGACGGAGGCATTATGCAGGGCAA
TGATATCTTCAAGGCTTTGGCTTTGGGAGCCAAGACGGTCTTTGTGGGTC
GTCCGGCTGTCTGGGGATTGGCCTACAATGGACAGAAAGGCGTGGAGGAG
ATGCTGAGTGTGCTGAGAAAGGACTTTGAGACCACCATGGCGCTGATCGG
TTGCCAAAATTTGGGAGACATCACGTCGGCAATGGTGGTACATGAGAGTC
AATATGCCAAGCTGGCAAGCTTTCTAGACCAT

BO30219.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:39:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG18003-RB 1101 CG18003-PB 1..1098 17..1114 5490 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:39:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG18003-RB 1322 CG18003-RB 85..1183 16..1114 5495 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 06:39:04
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 10884103..10884797 420..1114 3475 100 Plus
2R 25286936 2R 10883631..10884035 16..420 2025 100 Plus
Blast to na_te.dros performed on 2014-11-27 06:39:04 has no hits.

BO30219.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-12 10:53:00 Download gff for BO30219.complete
Subject Subject Range Query Range Percent Splice Strand
CG18003-RA 3430..4527 17..1116 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:49:43 Download gff for BO30219.complete
Subject Subject Range Query Range Percent Splice Strand
CG18003-RB 86..1183 17..1116 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:50:44 Download gff for BO30219.complete
Subject Subject Range Query Range Percent Splice Strand
CG18003-RB 86..1183 17..1116 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 07:50:44 Download gff for BO30219.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10884104..10884797 421..1116 99   Plus
2R 10883632..10884035 17..420 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:49:43 Download gff for BO30219.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 6771609..6772302 421..1116 99   Plus
arm_2R 6771137..6771540 17..420 100 -> Plus

BO30219.pep Sequence

Translation from 16 to 1132

> BO30219.pep
MALVCVEDFEKKAVGQLEKNALDYYRSGAGEQFTLGLNREAFRRLRLRPR
CLRDVSRLDISTKIFGEQMQWPLGIAPTAMQKMAHPDGEVGNARAAGKAG
SIFILSTLSTTSLEDLAAGAPDTIKWFQLYIYKDRTITEKLVRRAEKANF
KALVLTIDAPIFGHRRADVRNNFSLPSHLSLANFQGVKATGVGNAAMGAS
GINEYVSSQFDPTITWKDIAWLKGITHLPIVVKGVLTAEDAVLAQEFGCA
GLIVSNHGARQIDTVPASIEALPEIVKAVGDNLVVMLDGGIMQGNDIFKA
LALGAKTVFVGRPAVWGLAYNGQKGVEEMLSVLRKDFETTMALIGCQNLG
DITSAMVVHESQYAKLASFLDH

BO30219.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:10:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG18003-PB 366 CG18003-PB 1..366 1..366 1865 100 Plus