Clone BO30243 Report

Search the DGRC for BO30243

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:302
Well:43
Vector:pDNR-Dual
Associated Gene/TranscriptCG13188-RB
Protein status:BO30243.pep: Imported from assembly
Sequenced Size:1573

Clone Sequence Records

BO30243.complete Sequence

1573 bp assembled on 2011-09-12

GenBank Submission: KX798420

> BO30243.complete
GAAGTTATCAGTCGACATGGTGTCGCGTCGAAAAATTCTATCACGTTCCC
GCGACGATCTTAATCTCGACCAGACGTTCACCCAGCAGGAGGAGGAGGAG
GATATCTGGTTCCAGAAGGATAAACTATACAAGGAGCACATTCAGGAAGT
GCTGGACAAATGGACCCAAATCGACGACGAGATCTGGGCCAAAGTGATCG
TCTTCGAGCGGAATCGTCGCGTGGCCAAAGCGTACGCACGCGCCCCAGTG
CTGACCATTAATGGATCCGACGATGGCTTCGACGGCATGCGAATTGGACT
GTGCGGCTTCGACAATCCGATGAGGGATCAGAAGACCGACGAGATGAAGC
GCGTCATCGGACAGGGTGTTAAAATCAAAATGGATGACGCTGGGAACATC
CTCATCCGGCGGTACGCCAAAAGCAATGTCTACGTGAAGAGTACCGCCAG
CAGTCCCAACGAGGAGACCTCCATCGGTGCCGAGATCTTAAAGCTGCCAA
ATCAGGCGCTCGAATCCGAAAAAATAGTCAAGCTCTTCGACATGAAGAAG
TTCCAGTCGAATGTGAATCGAGAACTGCGTCGCGCCTATCCGGATCGCCG
CCGCTTGGAGACGCAGTGCCTCTCCGCGGTGGCGTTTGTCAAGTCGGAGA
ACGACATCTTGGAGTGCCCCATCTGGGTGCTCATCGTTAATGTGGTGGCC
ATGGATATGCTGAAGAGCAAACTGCCACCAGTGCAACGTCCCATTGTGGA
CATCAAGAACCGCCCGCGCATTCCGATTCCCGACGAGGATCCCTACAGCG
TCGCTGGCAACGGAAGTGGCGGTAGCTCCGGCAGCTCTGGCTTCGGCAGT
GGCCACCAGGCGCAACTGCATCCGCAGCAACAGCTGGGCAAGCATCTCAA
TGGCAACGGTGGAGGACATGTGGCCGCCACGCGGGAGCAGCTGCTGCTGC
AGACGCAACAACTGGCCCACAAGCGCAGCGAGAAACCTCCGAAACTACCG
CCCAGGGATAATATCTACTCGCACGATCTGATTCCAAAGCCGGACTACGA
TGATATCGATTTGGAGACCCGTATCAAACTGTCTCGCGGTAAATCTGACA
AGGGCAAAGATAATAAGAAATATGATGATCCCTACTACTGCGGCCTGCGG
GCCCGAGTTCCGAACTTTGTAAAGTCCGGCAAGCCGATACCCGCTCAGGT
TGCCAAGGATCAGCGGGATGGCAATGGGAACAATATCGGGAACGGCGGCA
TCAGCACGCTCAGCCAGAAGAAAACGTCGATGATCCACAACCATTTGGGC
GGCATGCATCCCCATCACATTCAACAGCAGCAACTGATGGCCGCGGCGGC
GGCTGCGCATGCGGCACAGCACCACCATGCGGGTCACCAGCGGGAGCAGC
AGCAGCACCACCAGATTTGGCAGACTCGCAGCTATGAGAGCGGCATAGAT
TCGGAGCTTGTTGAATCACCCTACAATCACATCTACGGACGCCATTTACC
GCTGCCAACGCGCGGCTACGTGCCCACGCCACGCATGTTCATCGGGGAAT
GGGACGCAAGCTTTCTAGACCAT

BO30243.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:40:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG13188-RB 1542 CG13188-PB 1..1539 17..1555 7695 100 Plus
CG13188-RA 3078 CG13188-PA 1..1432 17..1448 7160 100 Plus
CG13183-RA 1296 CG13183-PA 142..413 167..438 325 74.6 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:40:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG13188-RB 2842 CG13188-RB 707..2245 17..1555 7695 100 Plus
CG13188-RA 4532 CG13188-RA 707..2138 17..1448 7160 100 Plus
CG13188-RA 4532 CG13188-RA 3827..3935 1447..1555 545 100 Plus
CG13183-RA 2211 CG13183-RA 540..811 167..438 325 74.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 06:40:50
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 11964231..11964555 1124..1448 1625 100 Plus
2R 25286936 2R 11962670..11962981 728..1039 1560 100 Plus
2R 25286936 2R 11962375..11962575 531..731 1005 100 Plus
2R 25286936 2R 11962101..11962270 363..532 850 100 Plus
2R 25286936 2R 11955583..11955742 132..291 800 100 Plus
2R 25286936 2R 11950073..11950190 17..134 590 100 Plus
2R 25286936 2R 11966729..11966838 1446..1555 550 100 Plus
2R 25286936 2R 11964000..11964086 1038..1124 435 100 Plus
2R 25286936 2R 11961682..11961756 291..365 375 100 Plus
2R 25286936 2R 11906133..11906233 267..167 235 82.2 Minus
Blast to na_te.dros performed 2014-11-27 06:40:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6699..6898 1213..1414 175 56.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6757..6865 1306..1414 166 63.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6721..6852 1312..1445 160 60.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2304..2455 1304..1445 152 59.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2327..2441 1306..1423 150 62.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2324..2380 1366..1422 123 68.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2452..2651 1209..1414 112 56.5 Plus

BO30243.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-12 10:53:04 Download gff for BO30243.complete
Subject Subject Range Query Range Percent Splice Strand
CG13188-RB 780..2318 17..1557 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:50:35 Download gff for BO30243.complete
Subject Subject Range Query Range Percent Splice Strand
CG13188-RB 707..2245 17..1557 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:51:35 Download gff for BO30243.complete
Subject Subject Range Query Range Percent Splice Strand
CG13188-RB 707..2245 17..1557 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 07:51:35 Download gff for BO30243.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11966732..11966838 1449..1557 98   Plus
2R 11964232..11964555 1125..1448 100 -> Plus
2R 11964002..11964086 1040..1124 100 -> Plus
2R 11962674..11962981 732..1039 100 -> Plus
2R 11962377..11962575 533..731 100 -> Plus
2R 11962103..11962270 365..532 100 -> Plus
2R 11961683..11961755 292..364 100 -> Plus
2R 11955585..11955742 134..291 100 -> Plus
2R 11950073..11950189 17..133 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:50:35 Download gff for BO30243.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 7854237..7854343 1449..1557 98   Plus
arm_2R 7851737..7852060 1125..1448 100 -> Plus
arm_2R 7851507..7851591 1040..1124 100 -> Plus
arm_2R 7850179..7850486 732..1039 100 -> Plus
arm_2R 7849882..7850080 533..731 100 -> Plus
arm_2R 7849608..7849775 365..532 100 -> Plus
arm_2R 7849188..7849260 292..364 100 -> Plus
arm_2R 7843090..7843247 134..291 100 -> Plus
arm_2R 7837578..7837694 17..133 100 -> Plus

BO30243.pep Sequence

Translation from 16 to 1573

> BO30243.pep
MVSRRKILSRSRDDLNLDQTFTQQEEEEDIWFQKDKLYKEHIQEVLDKWT
QIDDEIWAKVIVFERNRRVAKAYARAPVLTINGSDDGFDGMRIGLCGFDN
PMRDQKTDEMKRVIGQGVKIKMDDAGNILIRRYAKSNVYVKSTASSPNEE
TSIGAEILKLPNQALESEKIVKLFDMKKFQSNVNRELRRAYPDRRRLETQ
CLSAVAFVKSENDILECPIWVLIVNVVAMDMLKSKLPPVQRPIVDIKNRP
RIPIPDEDPYSVAGNGSGGSSGSSGFGSGHQAQLHPQQQLGKHLNGNGGG
HVAATREQLLLQTQQLAHKRSEKPPKLPPRDNIYSHDLIPKPDYDDIDLE
TRIKLSRGKSDKGKDNKKYDDPYYCGLRARVPNFVKSGKPIPAQVAKDQR
DGNGNNIGNGGISTLSQKKTSMIHNHLGGMHPHHIQQQQLMAAAAAAHAA
QHHHAGHQREQQQHHQIWQTRSYESGIDSELVESPYNHIYGRHLPLPTRG
YVPTPRMFIGEWDASFLDH

BO30243.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:10:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG13188-PB 513 CG13188-PB 1..513 1..513 2718 100 Plus
CG13188-PA 1025 CG13188-PA 1..477 1..477 2512 100 Plus
CG13183-PA 431 CG13183-PA 1..425 1..472 913 43.5 Plus