Clone BO30251 Report

Search the DGRC for BO30251

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:302
Well:51
Vector:pDNR-Dual
Associated Gene/TranscriptCG34455-RC
Protein status:BO30251.pep: Imported from assembly
Sequenced Size:946

Clone Sequence Records

BO30251.complete Sequence

946 bp assembled on 2011-09-12

GenBank Submission: KX796915

> BO30251.complete
GAAGTTATCAGTCGACATGGCAGGTGCAACAAATGCGGACATCAAGCGGG
TTCTATCCATCCAGAGCCATGTGGTCCACGGCTATGTGGGAAACAAGGTG
GCCACCTATCCACTGCAGCTGCTGGGTTTCGATGTGGATCCACTGAACTC
GGTCCAGTTCTCCAATCATACGGGCTACAAGACCTTTAAGGGTCCCGTCT
CCAATGAAAAGGAATTAGCCACCATTTTCGAGGGTCTGGAGGAGAACGAG
CTGCTGCCATTGTACTCACACCTCTTGACCGGCTACATTGGAAATCCATT
GTTCCTACGCCAGGTGGGCCACATTCTCAAGAAGCTGCGTCAGGCTAATC
CTGGCCTGGTGTACGTCTGTGATCCGGTTATGGGTGACAATGGTCAGCTC
TATGTGCCCAAGGAGCTCTTGCCCGTGTATCGGGACGAGATCATTCCACT
AGCGGACATCATCACTCCCAATCAATTCGAAGTGGAGCTGCTCACGGAAA
AGGAGGTACGCAGCGAGGCGGCTGTTTGGGAGGCAATGGAGTGGTTCCAT
CAGCGTGGCATCAAGACTGTGGTCATTTCCAGCAGTGATCTTGGCCAGCC
TGGCGTTCTGCGTGCTTTCCTTAGCCAGCAGAATGGTCCCCGCCTGGCCA
TTGATATTCCGAAGCAGGGTGGCAAGGATTTGGTCTTCACTGGCACCGGC
GATCTCTTCGCCTCCCTTTTCCTGGCCCACAGTCATGGCAGCAAGGATAT
AGCCAATGTTTTCGAGAAAACCATCGCCAGTTTGCAGGCGGTGATCAAGC
GAACTGTGGCTTCGCTGCCCAACGGTGGAAACGGCCCAGTCAAAGCAGCC
GAACGGGAACTAAAGCTGGTGCAGTCCAAGACGGAAATTGAACAGCCCCA
GGTGCTCCTCAAAGCGCAGCGACTTAACGCAAGCTTTCTAGACCAT

BO30251.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:40:06
Subject Length Description Subject Range Query Range Score Percent Strand
Pdxk-RC 915 CG34455-PC 1..912 17..928 4560 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:40:07
Subject Length Description Subject Range Query Range Score Percent Strand
Pdxk-RC 1590 CG34455-RC 355..1266 17..928 4560 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 06:40:04
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 9361007..9361718 217..928 3560 100 Plus
3L 28110227 3L 9360670..9360771 17..118 510 100 Plus
3L 28110227 3L 9360841..9360942 117..218 510 100 Plus
Blast to na_te.dros performed on 2014-11-27 06:40:05 has no hits.

BO30251.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-12 10:53:02 Download gff for BO30251.complete
Subject Subject Range Query Range Percent Splice Strand
CG34455-RC 359..1270 17..930 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:50:13 Download gff for BO30251.complete
Subject Subject Range Query Range Percent Splice Strand
CG34455-RC 355..1266 17..930 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:51:15 Download gff for BO30251.complete
Subject Subject Range Query Range Percent Splice Strand
Pdxk-RC 355..1266 17..930 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 07:51:15 Download gff for BO30251.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9361009..9361718 219..930 99   Plus
3L 9360843..9360942 119..218 100 -> Plus
3L 9360670..9360771 17..118 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:50:13 Download gff for BO30251.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 9354109..9354818 219..930 99   Plus
arm_3L 9353943..9354042 119..218 100 -> Plus
arm_3L 9353770..9353871 17..118 100 -> Plus

BO30251.pep Sequence

Translation from 16 to 946

> BO30251.pep
MAGATNADIKRVLSIQSHVVHGYVGNKVATYPLQLLGFDVDPLNSVQFSN
HTGYKTFKGPVSNEKELATIFEGLEENELLPLYSHLLTGYIGNPLFLRQV
GHILKKLRQANPGLVYVCDPVMGDNGQLYVPKELLPVYRDEIIPLADIIT
PNQFEVELLTEKEVRSEAAVWEAMEWFHQRGIKTVVISSSDLGQPGVLRA
FLSQQNGPRLAIDIPKQGGKDLVFTGTGDLFASLFLAHSHGSKDIANVFE
KTIASLQAVIKRTVASLPNGGNGPVKAAERELKLVQSKTEIEQPQVLLKA
QRLNASFLDH

BO30251.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:10:43
Subject Length Description Subject Range Query Range Score Percent Strand
Pdxk-PC 304 CG34455-PC 1..304 1..304 1554 100 Plus