Clone BO30255 Report

Search the DGRC for BO30255

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:302
Well:55
Vector:pDNR-Dual
Associated Gene/TranscriptCG15111-RB
Protein status:BO30255.pep: Imported from assembly
Sequenced Size:1267

Clone Sequence Records

BO30255.complete Sequence

1267 bp assembled on 2011-09-12

GenBank Submission: KX796471

> BO30255.complete
GAAGTTATCAGTCGACATGTACGAGATTCATAATTGCCTAAGGTCCGTTT
TCTTAGCCACACTCATTCCCGGAACGATCCTACTTAGTTGGCTAACTGGT
CTGGTGGGTCTGCGATGTCTGCAAGCTTGTCTGCTGATCTTCTTCCTGAT
CTTCGTGGTCCTACCGTTGATCTTTCGGTATTCCGTAACGTTCCAGCGTG
GCATCCTATTTCTGACATTTATTAAGTATCCCAAAGGACTTGATCTCACC
AAGCCGGAAAGCGTGGGTCTTTATGCCACACGAAACTTCTACATAACCGT
AAAGGATCACGATCAGGACGAGGATGGAGTGCGAGTTGGTGTGTGGCACG
TGCTGCCCAGCAATGCAGTGCGTCGTTTTAAGCGCGAACTGCGCGTGGAG
GAGGAAGTGGCCCAGGACCCGGATCAGCAGCTGGATCCTGCACCTGGCAA
CGAACGCGAGCTGAAGGAGCTATCGCCAGCCATACGATCTGAATTTCCCG
TCGTGCTGCCGGAAAACGAGCAGCTCTTCTATGAGCGATTGCTGCGGATG
CCCGGCGGTACTGTGGTCCTCTATCTTCATGGGAACACAGCCAGCCGGGG
CAGTGGTCACCGATCGGAGGTGTATAAGCTACTGCGAAAGCTCAACTATC
ATGTGTTCTCCTTCGACTACAGAGGCTATGCCGACTCCGATCCCGTACCT
CCGACGGAGGAAGGCGTTGTGCGCGATGCCATGATGGTTTTTGAATACAT
AGCCAACACCACCTCCAATCCGATTGTGGTCTGGGGCCATTCCCTTGGCA
CCGGAGTGGCCACGCATCTGTGCGCCAAGCTAGCTAGCCTACGGGAAAGG
GCTCCCAGGGGAGTGATCCTCGAAAGCCCGTTCACCAACATTCGGGACGA
GATACGCATGCATCCGTTTGCCAAACTCTATAAGAATCTGCCCTGGTTCA
ATTTTACCATCTCGCAACCAATGTACACCAATAGGCTGAGATTTGAGTCG
GATGTTCATGTCTTGGAGTTCCGGCAACCCATCATGATCATCCATGCTGA
GGACGATGTCGTGGTGCCGTTTAATCTGGGCTATCGTCTGTATAGGATCG
CATTGGATGGCAGAAGTCGAACCTCGGGACCTGTGGAGTTCCATCGCTTT
GGGGCGAGCCGAAAGTATGGACACAAATACCTCTGCCGAGCACCGGAATT
GCCGGGACTGATCCAAAAGTTTGTGGAGAACTACCGTGACGCCGTATACG
CAAGCTTTCTAGACCAT

BO30255.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:10:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG15111-RB 1236 CG15111-PB 1..1233 17..1249 6165 100 Plus
CG15111-RA 1182 CG15111-PA 33..1179 103..1249 5735 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:10:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG15111-RB 1772 CG15111-RB 409..1641 17..1249 6165 100 Plus
CG15111-RA 1563 CG15111-RA 286..1432 103..1249 5735 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:10:45
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 19139876..19140903 222..1249 5140 100 Plus
2R 25286936 2R 19139694..19139822 103..231 630 99.2 Plus
2R 25286936 2R 19139264..19139350 17..103 435 100 Plus
Blast to na_te.dros performed on 2014-11-27 07:10:46 has no hits.

BO30255.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-12 18:11:34 Download gff for BO30255.complete
Subject Subject Range Query Range Percent Splice Strand
CG15111-RB 404..1636 17..1251 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:07:49 Download gff for BO30255.complete
Subject Subject Range Query Range Percent Splice Strand
CG15111-RB 409..1641 17..1251 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:04:59 Download gff for BO30255.complete
Subject Subject Range Query Range Percent Splice Strand
CG15111-RB 409..1641 17..1251 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:04:59 Download gff for BO30255.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19139876..19140903 222..1251 99   Plus
2R 19139694..19139812 103..221 100 -> Plus
2R 19139264..19139349 17..102 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:07:49 Download gff for BO30255.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 15027381..15028408 222..1251 99   Plus
arm_2R 15027199..15027317 103..221 100 -> Plus
arm_2R 15026769..15026854 17..102 100 -> Plus

BO30255.pep Sequence

Translation from 16 to 1267

> BO30255.pep
MYEIHNCLRSVFLATLIPGTILLSWLTGLVGLRCLQACLLIFFLIFVVLP
LIFRYSVTFQRGILFLTFIKYPKGLDLTKPESVGLYATRNFYITVKDHDQ
DEDGVRVGVWHVLPSNAVRRFKRELRVEEEVAQDPDQQLDPAPGNERELK
ELSPAIRSEFPVVLPENEQLFYERLLRMPGGTVVLYLHGNTASRGSGHRS
EVYKLLRKLNYHVFSFDYRGYADSDPVPPTEEGVVRDAMMVFEYIANTTS
NPIVVWGHSLGTGVATHLCAKLASLRERAPRGVILESPFTNIRDEIRMHP
FAKLYKNLPWFNFTISQPMYTNRLRFESDVHVLEFRQPIMIIHAEDDVVV
PFNLGYRLYRIALDGRSRTSGPVEFHRFGASRKYGHKYLCRAPELPGLIQ
KFVENYRDAVYASFLDH

BO30255.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:14:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG15111-PB 411 CG15111-PB 1..411 1..411 2167 100 Plus
CG15111-PA 393 CG15111-PA 12..393 30..411 2015 100 Plus