Clone BO30262 Report

Search the DGRC for BO30262

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:302
Well:62
Vector:pDNR-Dual
Associated Gene/TranscriptCG10171-RB
Protein status:BO30262.pep: Imported from assembly
Sequenced Size:1036

Clone Sequence Records

BO30262.complete Sequence

1036 bp assembled on 2011-09-12

GenBank Submission: KX798333

> BO30262.complete
GAAGTTATCAGTCGACATGCGTGACTGGATGCCAGTGCTCTTCTGCGGAC
TGTCCGTGCCGATCTCGCTGTTCATGTGGCTGGGCAATGTGGCGCTGTCC
AAGTTCTGGAGCAGTGACTTTGAGGGTTATCCGACAGAGTCCCGGGTGAT
TCCGCCGGTGCGCTGGCTCTTCTCCACACTGGCGCCCTTGGCCCTGATGA
CTGTGGCTCTGCGCCGGAGGAGCGTCAACCGATCTGGAGCTGCGCTGGGC
ATTCTGGTGGCCTTCATTCTCTCCATCGCCAGCCATCCGTTCTTCGCCAG
CTTGGTGGTGTTCTTCTTCAGCTCATCGCGGGCCACCAAGTTCCGCGCGC
ACATGAAACGCCGTTTCGAGAGCGATTTTCGCGAGGGCGAAGGCCAACGA
AACTGGATACAGGTACTCTGCAACGGAGGCATGGCCGCCCAGCTTGCATT
GCTTTATCTGCTGGACTGCGGTAGTGGCGAGCGGGCGGTGGACTTCGCAC
GAGAATACCGATCCAGCTGGCTGGGTGTGGCCGTTATGAGTGCGTTTGCC
TGTTGCAATGGCGACACCTGGTCCAGTGAACTAGGATCCGTGCTGTCGCA
ACGCGATCCAGTTTCTATCATCACCTGGCGCAGAGTGCCGCGCGGTACCA
ATGGTGGGGTTTCGTTGCTCGGCGTCGCGGTGAGTCTGCTCGGCGGTCTG
CTCGTCGGCTTTGGCTATTTCGTCACCGTTCGTTACACGGTTGAGGCCAA
AATGCTTCTGATTAGCCCACCACAATGGCCAATCATCGCCTTCGGTGGCA
TCGCTGGACTTTTTGGGTCCCTTTTGGACTCTGTCCTAGGTGGTCTGCTG
CAGTTCTCGGGCATCAATGAGGAAGGCAAGATTGTGGATACACCTGGAAA
GGGAGTGCGCCACGTAAGCGGACTGCGCATCCTGGACAACCATAGTGTCA
ACCTGATTTCCAGCATCGTCACCGGCGTCACCATTCCTCTCCTGGCCCAG
AGATTCTGGCCCGTGCGCGCAAGCTTTCTAGACCAT

BO30262.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:39:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG10171-RB 1005 CG10171-PB 1..1002 17..1018 5010 100 Plus
CG10171-RA 993 CG10171-PA 1..990 17..1018 4795 98.8 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:39:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG10171-RB 1845 CG10171-RB 134..1135 17..1018 5010 100 Plus
CG10171-RA 1611 CG10171-RA 60..1049 17..1018 4795 98.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 06:39:31
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 13386718..13387611 1018..125 4470 100 Minus
3L 28110227 3L 13387664..13387774 127..17 555 100 Minus
Blast to na_te.dros performed on 2014-11-27 06:39:32 has no hits.

BO30262.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-12 10:53:01 Download gff for BO30262.complete
Subject Subject Range Query Range Percent Splice Strand
CG10171-RB 96..1097 17..1020 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:49:56 Download gff for BO30262.complete
Subject Subject Range Query Range Percent Splice Strand
CG10171-RB 134..1135 17..1020 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:50:59 Download gff for BO30262.complete
Subject Subject Range Query Range Percent Splice Strand
CG10171-RB 134..1135 17..1020 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 07:50:59 Download gff for BO30262.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13387666..13387774 17..125 100   Minus
3L 13386716..13387610 126..1020 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:49:56 Download gff for BO30262.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 13380766..13380874 17..125 100   Minus
arm_3L 13379816..13380710 126..1020 99 <- Minus

BO30262.pep Sequence

Translation from 16 to 1036

> BO30262.pep
MRDWMPVLFCGLSVPISLFMWLGNVALSKFWSSDFEGYPTESRVIPPVRW
LFSTLAPLALMTVALRRRSVNRSGAALGILVAFILSIASHPFFASLVVFF
FSSSRATKFRAHMKRRFESDFREGEGQRNWIQVLCNGGMAAQLALLYLLD
CGSGERAVDFAREYRSSWLGVAVMSAFACCNGDTWSSELGSVLSQRDPVS
IITWRRVPRGTNGGVSLLGVAVSLLGGLLVGFGYFVTVRYTVEAKMLLIS
PPQWPIIAFGGIAGLFGSLLDSVLGGLLQFSGINEEGKIVDTPGKGVRHV
SGLRILDNHSVNLISSIVTGVTIPLLAQRFWPVRASFLDH

BO30262.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:10:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG10171-PB 334 CG10171-PB 1..334 1..334 1726 100 Plus
CG10171-PA 330 CG10171-PA 1..330 1..334 1686 98.8 Plus