Clone BO30265 Report

Search the DGRC for BO30265

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:302
Well:65
Vector:pDNR-Dual
Associated Gene/TranscriptRoe1-RA
Protein status:BO30265.pep: Imported from assembly
Sequenced Size:673

Clone Sequence Records

BO30265.complete Sequence

673 bp assembled on 2011-09-12

GenBank Submission: KX796888

> BO30265.complete
GAAGTTATCAGTCGACATGTCAGCAAAGGCAGCCTTACCACTGCAGATGT
TTGGCCGGCGACTCGTCCACCTGAGGTCATCGGTCACTTCTCAAAATATG
AGTGCCCTGCGTTTGTACAGCACAGAGAAACAGCCGGAAGAAGCGACAGA
GCAGAAGGCCACCGAATCGTCGCCAGAAGTTGAGAAACTCACCAAGGAAC
TGGCCGCCGCCAAGGAGCAGAATGCCGAGCTAATGGACAAATACAAGCGT
TCGCTAGCCGACAGCGAAAACATGAGGAACCGACTGAACAAACAGATCAG
CGACGCCAAGATCTTTGGCATCCAGAGCTTCTGCAAGGATCTGCTCGAGG
TGGCGGACACACTGGGACATGCCACACAGGCGGTGCCCAAGGATAAGCTC
AGCGGCAATGCTGATTTGAAGAACCTGTACGAGGGCCTCACCATGACGCG
CGCCTCGCTGCTGCAGGTGTTCAAGCGACACGGACTGGAGCCACTGGATC
CCATCAACCAGAAGTTCGACCCCAATCAGCACGAGGCGCTGTTCCAGAAG
GAGGACAAGACCGTCGAGCCCAACACCGTGGTGGAGGTGACCAAGCTGGG
CTACAAACTGCACGAGCGTTGCATACGTCCGGCCTTGGTGGGCGTGTCGA
AGTGTGCAAGCTTTCTAGACCAT

BO30265.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:39:50
Subject Length Description Subject Range Query Range Score Percent Strand
Roe1-RA 642 CG6155-PA 1..639 17..655 3195 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:39:51
Subject Length Description Subject Range Query Range Score Percent Strand
Roe1-RA 1065 CG6155-RA 105..743 17..655 3195 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 06:39:48
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 13554385..13554681 101..397 1485 100 Plus
2R 25286936 2R 13555025..13555284 396..655 1300 100 Plus
2R 25286936 2R 13554181..13554266 17..102 430 100 Plus
Blast to na_te.dros performed on 2014-11-27 06:39:49 has no hits.

BO30265.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-12 10:53:02 Download gff for BO30265.complete
Subject Subject Range Query Range Percent Splice Strand
Roe1-RA 100..738 17..657 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:50:05 Download gff for BO30265.complete
Subject Subject Range Query Range Percent Splice Strand
Roe1-RA 105..743 17..657 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:51:06 Download gff for BO30265.complete
Subject Subject Range Query Range Percent Splice Strand
Roe1-RA 105..743 17..657 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 07:51:06 Download gff for BO30265.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13555027..13555284 398..657 99   Plus
2R 13554387..13554681 103..397 100 -> Plus
2R 13554181..13554266 17..102 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:50:05 Download gff for BO30265.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 9442532..9442789 398..657 99   Plus
arm_2R 9441892..9442186 103..397 100 -> Plus
arm_2R 9441686..9441771 17..102 100 -> Plus

BO30265.pep Sequence

Translation from 16 to 673

> BO30265.pep
MSAKAALPLQMFGRRLVHLRSSVTSQNMSALRLYSTEKQPEEATEQKATE
SSPEVEKLTKELAAAKEQNAELMDKYKRSLADSENMRNRLNKQISDAKIF
GIQSFCKDLLEVADTLGHATQAVPKDKLSGNADLKNLYEGLTMTRASLLQ
VFKRHGLEPLDPINQKFDPNQHEALFQKEDKTVEPNTVVEVTKLGYKLHE
RCIRPALVGVSKCASFLDH

BO30265.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:10:42
Subject Length Description Subject Range Query Range Score Percent Strand
Roe1-PA 213 CG6155-PA 1..213 1..213 1075 100 Plus